SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020224 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020224
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily PH domain-like 5.73e-23
Family Pleckstrin-homology domain (PH domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 172-255
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000042
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020224   Gene: ENSGACG00000015332   Transcript: ENSGACT00000020263
Sequence length 364
Comment pep:known_by_projection group:BROADS1:groupIII:7543983:7547076:-1 gene:ENSGACG00000015332 transcript:ENSGACT00000020263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPVRQRSGPGGPRAQLPPCYYEGYLEKRGPKEKAARRLWTCLCGNSLYFFNNAKDSH
FVEKLDLSGFVSLKDDCSRDRNLEAARLILRMKDGETKLTAPNLESRELWKGFLYSVVDL
NVPSCLTLLPGQLQMLREIVDKERSRRRNRTPTRAPPSPLSVPLVGEIPPRPVSRTEAEV
LLERHPDCGNMLLRPGRDGCSLAVTTRQDLNGSVFRHYRVTQRDQGGYVIDVENPIPCAT
LHEVIDALVEKTAGTLQPFLLEEPYEENITYVSANDENGEKILHTAPSSPLPKAPALPPK
QGADRWPSSPLSRSPAPDRRILTSPAPASPTNPMRRLILSPSPLAQTLNEELKMKLEMRR
ATQD
Download sequence
Identical sequences G3PRI8
69293.ENSGACP00000020224 ENSGACP00000020224 ENSGACP00000020224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]