SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020228 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020228
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000689
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020228   Gene: ENSGACG00000015337   Transcript: ENSGACT00000020267
Sequence length 258
Comment pep:known_by_projection group:BROADS1:groupII:7763793:7765546:1 gene:ENSGACG00000015337 transcript:ENSGACT00000020267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHKLKSSQKDKTRQFMSFTQAGERTAVYCLTRNDWKLEVATDNYFQNPDLYYKESMKTTA
DRKKLDQLYNRYKDPQDENKIGIDGIQQFCDDLTLDPASMSILVVAWKFRAATQCEFSRK
EFLDGMAELGCDSPEKLKSILPRLEQDLKDTGKFKDFYQFTFNFAKNPGQKGLDLEMAVA
YWNLVLTGRFKFLDLWNRFLMEHHKRSIPKDTWNLLLDFGNIIADDMSNYDEEGAWPVLI
DDFVEFARPIVTSKRNIT
Download sequence
Identical sequences G3PRJ2
ENSGACP00000020228 69293.ENSGACP00000020228 ENSGACP00000020228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]