SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020266 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020266
Domain Number 1 Region: 2009-2180,2220-2355
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.94e-29
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.062
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020266
Domain Number - Region: 1654-1688
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000586
Family TFIIH p44 subunit cysteine-rich domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020266   Gene: ENSGACG00000015362   Transcript: ENSGACT00000020305
Sequence length 2369
Comment pep:known_by_projection scaffold:BROADS1:scaffold_48:1393797:1410996:1 gene:ENSGACG00000015362 transcript:ENSGACT00000020305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFSRNMVVMNDQVLEPQNVDPSMIQMTF
LDDVVHSLLKGENIGITSRRRSRSSQNNNSTHSHYTRAQANSPRPPASQSHHSPGGSGRD
QREQRNARSSRRKGSDSSVPEEEKERREESTARGEDVADSKAKAKQAVNKRRKVEEDEKK
AGLKRLKTDMTSDLSESSDSENPHNKRTAHSSCSSSSSSDVKQSGISKKEEELQPTIQGT
KINNSSSAIGRLSPWAELQPAEDCKKGVAKNTGKMSTKEEEEELVASSEAVSALLASQKA
ESTALSPYLPLNPSPVSSPPVPPSPSPSEGGRRTDIEPPMQPQGIVGGENIPPSSSSSSS
SSSSSTAETRKHPLQQAPPHKMNTVPPAELARSRMSPNTAPTQLNTLKQKPQHPNNSQSH
PYPNTNPADLLKAKPHPGLLDISKPKPNTSPEVSKHKIQRYSDTSPPPMGRLSAKVEPTE
PPRSGFKPVAARSETGGVSTSSSTKSPLIIDKNETFTVYRDPALVRSDAENSVSVSVSSN
HVAAYLHPHLHTLHSPTPHSSCLTSASHSHLLAPPHTSALPHPHLLPPGVLPGMPPPAAS
LLGGHPRLDSPSGLGHLALSHPASAHQQRFLQGPPPPSLLAQAHGGAAGLGLYPILWQYP
NGTPTSYPPGLNLPPTAKWVHSENPISLNSESSLRRNTTSPWLHQSAGSAGDGLGLLSHV
PVRPASADPHRPSMKISSHTSPPLSKSSMNTHKEDPDKKGFMDPIRTLTLKQEQTDRSRT
PERKDVHLHRLYLDPHSKAHLANTQAADRASKYKEENRQILKESIEVAPFTAKMQRSGDP
GMDRERCRDAPFPVRLPALASPSPKAGHIHPHIIQSEKSNYFTTLSNSVVNEPPRLYPSK
EFSSYYEKVSGGAPGGALSLGSYTSKASLSKPPPLIKHQPEGGEGLAGKITEQLSQQNHH
HHHQQLQHHHQQHQHQQQQQQQQQLRAMPSLHRAPVFHPPTQHALDRKDAAEREREKERE
RERTVYGGRLSPPTLTPIQPVSLASAGSKTSAEQQKPPTLLPELRDVKAIGGEIATPSVD
AWRHGEMIQERGGTLRGKPQSAMASVIVRPSSSVKYDSLVGANQSGAMITKELPHGRFYP
ASLQGEGLRLGECVREVAAGRVIQPNSNLDEMCFQYKHSSMRDMQGNVSAGITNSVCRTA
ISAASLFGIQSISGTAIPDLGYSVSAHKTGICGRVLSHSGPREYQEGLGSRTTSPGGSLL
PPSPVGTPQPSPSLTPTPSSIAGSSQPYSSSFVHLKKHKAALAAAQFRSNFSPAPTSVSI
GNCFLPVDSVDKTPIRNSPPPPASSQASSSGQPSNYHKLKKAWLTRHSEEDRNTTVTPSC
TKMIKPCTVNLSASTSSEVELSKDGKAERERQLADKERKAAPSLRRGNKRSYESASESGG
DDSDTSESKMEGRAKRQPKPTFKKKQNDMARRKGDNEKEDDDLKPNGIFRSAREKTKLKL
ASSSKYYGIPRSVLKDWRKVKKLKQTGESFLQDDSCAEIGPNMQKCRECRVVRSKKGEEP
THSPVFCRFYYFRRLSYSKNGVIRMDGFSNPDQFDDEALALWVPGLMDESQLDQTTAKYI
LSFIGDKFCQMVVTENTAATWIKKDAKLAWKRAVRGVREMCDACEATLFNIHWVCQKCGF
VVCLDCYKAKERRSSKDKELYGWLKCVKGQPHDHKHLMPTQIIPGTVLTELVASMHSLRE
KHNIKPHCPCTTKQNLNTKLPATNGVSQVLQNVLNHSNKLALVKAEPGSQQNSDQVGTKV
ETNGGGRGGSSPGSDAGSAPVTPPESQSPLHFLADLAEQKSREEKKENKSVLLGKSVKED
KVGDSLEVLQQCKTTSLVANSTEQGSTLRDLLTTTAGKLKLGSTDAGMAFAPVYSTASQT
GKGGRTMPNILDDIIASVVENKIPASRQSVTTKLSIKHEPIAPGNHNNNPAPAVTAAVTE
DLTNQYPDIPHCWLNNRRLLWLKDHRNQNNWKLFRECWRQGQPVLVSGIHKRLNSGLWKA
DSFNQEFADHQGDLLNCKDQVVSNSGIKEFWDGFEDITKRPKSKDGEPMVYRLKDWPSGE
EFMALMPSRYDDLMKNLPLPEYSDPEGVLNLASHLPSFFVRPDLGPRLCCAYGVAASQDQ
DFGTANLHVEVSDVVSVLVYVGVAKGNGVLSKTGVLKRLEEEDLDEGVRRRLKDSSETPG
ALWHIYLNKDMDRVREFLHKQQGSDAPADQDPIREQGSYLSRKQRQRLLEEHGVQGWTVV
QFLGDSVLIPAGAMHQVQNLHSCVQVINDFVSPEHVANSFHLTQELRPSKEEVNYEDKLQ
VKNILYHCVKEAVSSLKRSSSEEGDEEEN
Download sequence
Identical sequences G3PRN0
69293.ENSGACP00000020266 ENSGACP00000020266 ENSGACP00000020266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]