SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020323 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020323
Domain Number 1 Region: 456-632,745-1000
Classification Level Classification E-value
Superfamily Ras GEF 1.07e-110
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 199-337
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-37
Family DEP domain 0.00000108
Further Details:      
 
Domain Number 3 Region: 653-754
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.43e-31
Family Ras-binding domain, RBD 0.0015
Further Details:      
 
Domain Number 4 Region: 21-158
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-23
Family cAMP-binding domain 0.00000102
Further Details:      
 
Domain Number 5 Region: 330-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-22
Family cAMP-binding domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020323   Gene: ENSGACG00000015410   Transcript: ENSGACT00000020362
Sequence length 1002
Comment pep:known_by_projection group:BROADS1:groupIII:7954694:7972354:-1 gene:ENSGACG00000015410 transcript:ENSGACT00000020362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVQTSLSSSPLAEWIRCLDKRPSERSGEDVDIILTRLREVKAFHRFPPALLLQICACA
FYECLEKGITWSTVFRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGES
ILDNTPRHATIVSRETSELLRIEQREFKSLWEKYRQSLAGLLAPPYGAMESGSNNDRLSD
KDNMNSDSANKAHNKIPSEKLQRAGKVLRNAILSRAPHMIRDRKYHLKTYSRQCCVGTEL
VDWLVLQSACVLTRSHAVGMWQALLEEGVLNHVDQELGFQDKYLFYRFLDDEEEDTPLPS
EEEKRESEEELPETILLLAQIGPDALLRMILRKSPGQRTGDDLEIIYDELLHIKALAHLS
NTVKRELASVVIFESHAKAGTVLFNQGEEGTSWYIIQKGSVSGPCLSQGVVCTLHEGDDF
GKLALVTDSPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHEQAVLVLEKSP
RASTLGSIKYTVISGTPEKILEHFLEAMRMDIHHSEPVLDPAVDDFVLMHGVFMPNSQLC
PLLLAHYHTTSPPGSEQERLEYALNSKRRALILALRWASTQTYLLQEEPAAISFLEELYG
SLSNDSRILRALKDFVPDLEKIVKSHSEEAKSMKKKTLIRQFSNGEERLQKKQPIRNHDD
ILLKVYCGDHTYTTIRVAVAATGREVISAVADKLGTTDELVLLHLSSACEKQILKQNDVS
VFSALSINGRLFACPRDQLGSLTPLPDQEGPSAGSMSTFELMSSKDLAYQMTLYDWELFS
CVHEHELLYHTFGRASFRRTTANLDLFLRRFNQVQLWVVTEVCLCSQLSKRVQLLKKFIK
IAAHCREFKNLNSFFAIIMGMSNPAVSRLSQTWEKLPTKFKKFYAEFESMMDPSRNHRSY
RLTVTKLEPPIIPFMPLLLKDMTFTHEGNKTFIDNMVNFEKMRIIANTIRQVRHCRSQPF
NPEICQPNKNQADVRGYVRKLCVIDNQRALTQLSYRMEPRRT
Download sequence
Identical sequences G3PRT7
69293.ENSGACP00000020323 ENSGACP00000020323 ENSGACP00000020323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]