SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020381 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020381
Domain Number 1 Region: 404-536
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-34
Family DEP domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-24
Family DIX domain 0.0023
Further Details:      
 
Domain Number 3 Region: 229-340
Classification Level Classification E-value
Superfamily PDZ domain-like 1.33e-23
Family PDZ domain 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020381   Gene: ENSGACG00000015451   Transcript: ENSGACT00000020420
Sequence length 693
Comment pep:known_by_projection group:BROADS1:groupIII:8049005:8059067:-1 gene:ENSGACG00000015451 transcript:ENSGACT00000020420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETKIIYHLDDQETPYLVKLSVPADKVTLADFKNVLKKPNYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSGDGAHTDASSVADSIDAALPLERTGGIGDSRPPSYHGIAA
SGRDSLDNETETGSMVSQRRERDRPRRKHTNEHGGRQNGHPGRSIGRGGPEYDSCSSFMS
SELESTSCYDSEDDDATSRFSSSTEQSSSRLMRRHRRRRRKPKASNIDRSSSFSSITDST
MSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQV
NDINFENMSNDDAVRVLRDIVHKPGPITLTVAKCWDPNPRSCFALPRSEPIRPIDPAAWV
SHTAAMTGVYPAYGMSPSMSTVTSTSSSISSSIPETERFDDFHLSIHSDMATVAKAMACP
ESGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFSDRREARKYASNLLKAGFIRHTVN
KITFSEQCYYVFGDLCGNMTHLSLHEHDGSSGGASDQDTVPPLPHPGAAPWPITLPYQFP
VLHPYDMQQPGHGGPGAGSAGSQNSVINIPSNSSKGSSGSNCSKNEGRKSGGSGSEPEIR
SHRAPSERSAAPPSERSVRSSVSHRSAHSHSIAFGPGLVYGPPGLPPQPPLSTAAPGAPP
GRELASVPPELTASRQSLRMAVGNAGEFFVDVM
Download sequence
Identical sequences G3PRZ5
ENSGACP00000020381 ENSGACP00000020381 69293.ENSGACP00000020381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]