SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020537 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020537
Domain Number 1 Region: 433-568
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.1e-39
Family Synaptotagmin-like (S variant) 0.00000153
Further Details:      
 
Domain Number 2 Region: 268-399
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.38e-35
Family Synaptotagmin-like (S variant) 0.0033
Further Details:      
 
Domain Number 3 Region: 2-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020537   Gene: ENSGACG00000015567   Transcript: ENSGACT00000020576
Sequence length 577
Comment pep:known_by_projection group:BROADS1:groupXIV:354803:359786:-1 gene:ENSGACG00000015567 transcript:ENSGACT00000020576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELTDEEKEIINSVLARAAVMEATEHQRIQRLSSRLEDIRRTARGDGRSHCLLCGASLGP
QGVTAALCVRCNKHMCSQCGINGSSRTSPVWLCRICNEQQEVQKRSGAWFFKGRVQQALP
DPLPLSGPPQSGTEDGSGPREPHRGYGCPQRRPGQQPRAMTRVLPVPPWGRKPRDPPPNH
PEPTHSRWPSPQVKQPPPPRPGGSRRLQTRLIAPAAGVENKRPGREETAWPPAAEEKRPP
RVPATRTDPPGNGTAPPQPPPDRTEDSDDSDDSTTLGSLEFSLLYDQEHHALHCCIARAK
GLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLKTTLNPAWNETLVYHGITDDEMSRKT
LRLSVSDEDKFGHNEFIGETRVALKKLKFNQKKNFSVCLERVVPVKKAVGGSVRGMALYE
DDQANEAEDSEERGRILVSLTYSSQQGRLIVGVVRCAHLAAMDSNGYSDPFVKICLKPDM
GKKAKNKTQIKKKTLNPEFNEEFGYEIKHGELAKKTLDISVWDYDMGKSNDFIGGCQLGI
QAKGECLKHWYECLKNKDKKIERWHVLLNDNSAQFED
Download sequence
Identical sequences G3PSF1
ENSGACP00000020537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]