SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020542 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020542
Domain Number 1 Region: 451-586
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.4e-39
Family Synaptotagmin-like (S variant) 0.00000153
Further Details:      
 
Domain Number 2 Region: 304-437
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.61e-32
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 3 Region: 11-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.33e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020542   Gene: ENSGACG00000015567   Transcript: ENSGACT00000020581
Sequence length 592
Comment pep:known_by_projection group:BROADS1:groupXIV:355448:359821:-1 gene:ENSGACG00000015567 transcript:ENSGACT00000020581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSAWTMDAEELTDEEKEIINSVLARAAVMEATEHQRIQRLSSRLEDIRRTARGDGRSHC
LLCGASLGPQGVTAALCVRCNKHMCSQCGINGSSRTSPVWLCRICNEQQEVQKRSGAWFF
KGRVQQALPDPLPLSGPPQSGTEDGSGPREPHRGYGATMNTCTLGTFRCIWIPIPAYFHL
TKGLNVGLLPGDTLCSHVVLMLSSETARTTAEGHDEGPSCPAVGTETERPASKPPGANAQ
QVALASDSRGLALETRWEQTASDTVDCSCCRCGKQTPREGGDGVASSCRGEETTACSRHQ
NRSTGQPTLGSLEFSLLYDQEHHALHCCIARAKGLKPMDSNGLADPYVKLHLLPGASKFV
PQSNKLRTKTLKTTLNPAWNETLVYHGITDDEMSRKTLRLSVSDEDKFGHNEFIGETRVA
LKKLKFNQKKNFSVCLERVVPANEAEDSEERGRILVSLTYSSQQGRLIVGVVRCAHLAAM
DSNGYSDPFVKICLKPDMGKKAKNKTQIKKKTLNPEFNEEFGYEIKHGELAKKTLDISVW
DYDMGKSNDFIGGCQLGIQAKGECLKHWYECLKNKDKKIERWHVLLNDNSAQ
Download sequence
Identical sequences G3PSF6
ENSGACP00000020542 ENSGACP00000020542 69293.ENSGACP00000020542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]