SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020554 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020554
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-30
Family Ubiquitin-related 0.00000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020554   Gene: ENSGACG00000015581   Transcript: ENSGACT00000020593
Sequence length 101
Comment pep:known_by_projection group:BROADS1:groupI:27801691:27803793:1 gene:ENSGACG00000015581 transcript:ENSGACT00000020593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTETKPSSQDGGDKKDGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYSQRQGVPAS
TLRFLFEGQRIADNQTPKELGMEDEDVIEVYQEQTGGLWND
Download sequence
Identical sequences G3PSG8 I3K2K9
ENSGACP00000020554 ENSGACP00000020554 ENSONIP00000015354 XP_003446582.1.78416 XP_008293061.1.38333 XP_010753155.1.61708 XP_018516789.1.34915 69293.ENSGACP00000020554 ENSONIP00000015354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]