SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020562 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020562
Domain Number 1 Region: 221-299
Classification Level Classification E-value
Superfamily PH domain-like 4.57e-21
Family Phosphotyrosine-binding domain (PTB) 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020562   Gene: ENSGACG00000015592   Transcript: ENSGACT00000020601
Sequence length 301
Comment pep:known_by_projection group:BROADS1:groupII:9215026:9224026:-1 gene:ENSGACG00000015592 transcript:ENSGACT00000020601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDTLRTREEEGEAESEEYCHHEEEDEDDGGGEEQRHGRGYTGDYYAPEDNGNSVRVSPY
CSRKVLVVEGETGEEAEEDIDQIVAEIKMSMSMGSLSSGTDQSPEELLQDPAPSDYSHPK
PDAAPYPQAPHRHDSRPKSLNLPSVHHNTPDLKRGIKAHARSPEDRQRWTQEQVSNGAEQ
PRKPQRSDLNVPLENNNVLEPTKKVASFPSFVDVPGPCEPEDLIDGIIFAANYLGSTQLL
SERNPSKNIRMMQAQEAVSRVKGAEGDAQTLTEVDLFISTQRIKVLNADSQVRIGQHAFP
T
Download sequence
Identical sequences G3PSH6
69293.ENSGACP00000020562 ENSGACP00000020562 ENSGACP00000020562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]