SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020615 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020615
Domain Number 1 Region: 140-284
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-33
Family Pleckstrin-homology domain (PH domain) 0.0000432
Further Details:      
 
Domain Number 2 Region: 53-87
Classification Level Classification E-value
Superfamily WW domain 0.0000000356
Family WW domain 0.003
Further Details:      
 
Domain Number 3 Region: 4-40
Classification Level Classification E-value
Superfamily WW domain 0.000000178
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020615   Gene: ENSGACG00000015632   Transcript: ENSGACT00000020654
Sequence length 1267
Comment pep:known_by_projection group:BROADS1:groupII:9447815:9498650:1 gene:ENSGACG00000015632 transcript:ENSGACT00000020654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLGRDTLPDHWSYGVCGDGRVFFINDKSHSTTWLHPHTGEPVNSGHMIRSDLPRGWE
EGFTDEGASYFINHSLRATSFRHPVTGQISPENTEYTLQDRIEARMSKSAANQRSPSMVT
ESSKAVTSAAADAHSGTKGCRGAGKVHSFGKRDHAIKRNLNIPVVVRGWLYKQDSSGMRL
WKRKWFVLSDYCLFYYKDSREETVLGSIPLPSYVIAPVEPDDHINRKYAFKASHTGMRSY
IYNKNSVIGSQAEHCGMRTYFFSADTQEDMNGWIRAMNQAALMQQSHTIKRAAENPKEAA
QQTLPQTNHVHVNQNACQSESLSRAEKPPYNGIQLAHREEVRYGLEIEGKPNHSAAERLS
PDCVDDATHKKGQPTVIEVALPPEQNGNPVRQRGFVSHVDPEKRVQRKNTLAKVEKWVKV
QKGDPPKSAPCAEYDLPRRTPPLKPKACTEADAAYQSLPKSPRLPSGCASPPASCKLPSD
YKYAHDRLSHFRMSTDERMATKEGMVWQLYEWQQRQQFRHGSPTAPIYTGPNFTDSSSFR
VTVEMPRSISVPPSPCEVPPSPPPSSPCPPRRPHTPSDRRTIRPLDDVAHEDSTRSSSPG
HICAHLSQQASQIERRSMPAMGYITHTVSAPSLHGKTADDTYIQLKKDLEYLDLKVTGRD
SLKTERPAKPVKIAESDADVKLSQLCEQDKILQELEAGIRSLKEDKDKLESVLDVSHQQM
EQYRDQPAHAEKIAYQQKLLQEDVVHIRAEISQVSTEMENAWNEYSRLERDVDWLKSALQ
GQMNRSDLSQQDKVQIRKELWRIEDVIAGLSTSKANYKVTISSLTNPERKFVPSVSASSV
PSVPGSPSAVEMRLQPSPQPQRPQRRPLLQPQPAALPSLANIPKLTDIQSEINSQQCFFV
QGGEDVPPRPPLPQLYNPDEHPPAVPPLPRETTVIRHTSVRGLKRQSDERKRDREVGQFT
NGDSKVEFRPFLSDPELMGAGDGASHISIATSGHDGYQTLPSRGVAGSSLRLNQSSGVSS
YVTLRRAASAAGMKLVLERPKSALERLYSGDSVQQQRGKMSADEQLERMKRHQKALVRQR
KRTLSQGDRHASPSSRTSSSSSRPLSADLGSWKREQEFDLQLLERAVQGEEAQRSDEWLT
LRSTTPSSHEVDLEPLDFDLDLNKELSKPQKVLIPERYVDSEPEEPLSPQELEDRHRKVE
RIKSILAKSSVQNLAPGVTLDKPEVGLVALDSALQEQERIITMSYALASEASLKSKLVTE
AQIVSNC
Download sequence
Identical sequences G3PSM9
69293.ENSGACP00000020615 ENSGACP00000020615 ENSGACP00000020615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]