SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020648 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020648
Domain Number 1 Region: 1001-1128
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-28
Family Bromodomain 0.00039
Further Details:      
 
Domain Number 2 Region: 946-995
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000199
Family PHD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 58-116
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000114
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020648   Gene: ENSGACG00000015655   Transcript: ENSGACT00000020687
Sequence length 1174
Comment pep:known_by_projection group:BROADS1:groupII:9988924:9998251:-1 gene:ENSGACG00000015655 transcript:ENSGACT00000020687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQNCSECSVPTLAQSLCTLCNKWLCYQCTDVHQHQRATTTYHYTDMHKQQRPSPGSYPC
SLLMCHAHRQEPLELFCESCDLLCCSSCHLSSHKNHRVVQIGNALQDQQWLFESLMVQVD
ERRSAVENNAKQLEERLHGVKIAHRKAENQIKMAKMIMMNELNKRANLLIEQLEKISEDF
QHRLEDHLQGAIEICGQLDHVQKFITWATTHHCRGPVLFSRALMSLQMQQLLESSLHSDS
WSPVRIKFNWDASYWTKQISSLVAQPIASRWTKLLMLHAISAGQLNVEGGDSIYPRGLPC
SSILRPQPINRLALPSVCHRGRELGCGYQNCCEPQLCCVHGIPSAPDPSRPDKGQLEAVL
HNSSCVRPALFSASLHQNQQLQRCWDPDNSLQCPPPSSPVSVTGPIQTQPQTEPYLQRPH
QRDVLSDSRAQPGAEHRMPGRRQRTLSTNAPLQQQVGHAAADRDAMNDENWEEKCRVEEA
PGQAAVVESRALADGELQRDRREQSSVQQEQQQLRVAPAAELRRELQRNSPAVTLRDHRD
GRFCHVSMASNKTTSPIYMHLLKPTMYESESGLFSVQRSNTCSDGATEMCFCFYEERTLR
KQRAGLTITAELFLAMHPKIRRAPLVIITLKATLKGSGRHIITSPKSQGAYVQTQDELFL
LPVKSPKTTWASFMYLKSFQKEGLSFLVFSPPHSKSCIRFPSGEDQQIICYSSLIKSSLS
NCPPEHKSHECVSDVQSSRLGPALVCRGRDRRSQSIPPELAAPSTSPYSERPPGCAQSPR
AVAETKVTLHQNIIKVHLSCQKELRSFGVLQSNSLRQTQSRKMNMNITLIKGTEKLSSSQ
SNRDVQKDSGRPRVPVVCLERLKILVSQLPPHGRRQSDPLPASGTEKSEAPPQQRAGRDA
RPEADPDPQLYSDASPDSPRNAESSSESDREAQSFAEADQDCPEMESEDFCAVCLIGGDL
LCCDRCPKVFHLSCHIPSLLSFPSGDWLCSLCRDVMQPEVEYDCENKRTSGGHTPAHGLP
VCDQRKCERLTLLILSNVLSAPFHEPVSPLARHYYQIIKRPMDLSVIRAKLNKRNTQHYI
STEEFVADVYLMFRNCAKFNYPDSEVAQAGRNLEMFFISNLKEVFPDRVFPAAQADSDSD
EYDEAYRAAESGFPWPERREQCLRKRKRRPSLKS
Download sequence
Identical sequences G3PSR2
69293.ENSGACP00000020648 ENSGACP00000020648 ENSGACP00000020648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]