SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020670 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020670
Domain Number 1 Region: 105-164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000377
Family PHD domain 0.0098
Further Details:      
 
Domain Number 2 Region: 47-96
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000247
Family Tudor domain 0.0071
Further Details:      
 
Domain Number 3 Region: 203-278
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000443
Family PHD domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020670
Domain Number - Region: 599-620
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0655
Family Chromo domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020670   Gene: ENSGACG00000015665   Transcript: ENSGACT00000020709
Sequence length 623
Comment pep:known_by_projection group:BROADS1:groupIII:8841995:8849368:-1 gene:ENSGACG00000015665 transcript:ENSGACT00000020709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVSGDVDHLSVHHRALPQRQQQAVSGSPTSLSARGEYGEDSMSDRFTEGQDVLARWSDG
LFYLGTITKINREKQQCFVVFEDRSKSWVLWKDIQTGNFFNFNIYIVCSICQDETSDEPN
EIVICDKCGKGYHQLCHSPTIDASVIDSDDKWLCSDCELTCRPKREAANMRGASAQGFVE
QELQEKHTGLHLSLPYALDELVWDQAHETNIQQCYCYCGGPGDWYLKMLQCNGCLQWFHE
ACLHCLQIPMFYGDRFYLFICSVCNGGPEYLSRLPLTWENVTHLSLYNLSVIHKKMYFDS
EMLLMSYINDNWELLQLGELGNTPRSQRYGRVLEALNNNSSIFKSGKEVKKKKHLFSLRI
RFPPAPPNSHEPSGRGMDRTSHEINIKGCKSTKTPPGMMSLTNGTEKKKKRKQGARSLET
LAKPQCSERLSQNLRRPLPLEPNTLDHLTAAKLKCVIYFEFTFTRRERPQLSTSDVESIG
ALSTTETTSTSISRPSRRTSCSSSKTRTTACIMPVSAPLLKRKRGRPRRAPQPPRPEILP
PSHADPNPSATEMMSPLPRLHSADIVHGMDPNSQLSHLKSSISSYFGAAGRLACGEKYKV
LARRVTLDGKVQYLVEWEGVTAS
Download sequence
Identical sequences G3PST4
ENSGACP00000020670 ENSGACP00000020670 69293.ENSGACP00000020670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]