SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020701 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020701
Domain Number 1 Region: 1107-1247,1323-1589
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.94e-106
Family Myotubularin-like phosphatases 0.00000643
Further Details:      
 
Domain Number 2 Region: 1736-1842
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-27
Family Pleckstrin-homology domain (PH domain) 0.0000206
Further Details:      
 
Domain Number 3 Region: 883-1024
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000221
Family GRAM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020701   Gene: ENSGACG00000015683   Transcript: ENSGACT00000020740
Sequence length 1845
Comment pep:known_by_projection group:BROADS1:groupII:10126536:10191562:-1 gene:ENSGACG00000015683 transcript:ENSGACT00000020740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFADYFIVVGYDQEKVDSGEGCGKIIQRFPKKDWEGTAFPQGVEMFCQPGGWRLSRER
KAPTFFTVVLTDIDSDRHYCSCLTFYEAEVNLQGSKSIEADGDEDEEAEEDGLIQPAQVF
APKSLILVSRLDYPEIFRGCLGLIYTVHIDSLSFPLESLVANLFAFQVPVAGGSQKLFSL
GAGDRQLIQTPLNDTLPITCKSVGLLFQQLGIQNVLSLFCAVLTEHKVLFHSTSYQRLEE
ACRALEALMFPLKYSYPYIPILPSRLLEVLSSPTPFIIGVHSMFQTEIQDLLDVIIADLD
GGTIKIPECIHLSPLPEPLLHQTQTSLSLVLHPDLEIADNAFPPPRTAASNPKLLDKEVR
AVFLRLFAQLFQGYRSCLQLIRIHSEPVIHFHKTAFLGQRGLIENDFLTKVLDGMAFAGF
VSERGPPYRACDLFDELVALDTDIFKEEEASPAKLQKHIRAFSEQLYRNENPNPHMAFQK
VPRPSEGSHMRVHQVPFPLLDDEHVEKMLQEGVAKHSSAPASTRPERKCVVPAGPPVVSI
MGKSGSVFNSARRLEVVRSCISFIFDNKTLETEKALPAALRALKSKAARHCLTEELSLHV
QQNRAILDHQQFDHIIRLMNCALQDCSSSEEYTVAAAVLPLSTAFYRKLAAGVNQFAYTC
IQDHPIWTNQQFWEATFYSEVQSQIRALYLNTPQGKDCITVRLKDAGPEAAAGGAEEHTA
MALAAMQLRSWPGLSKEKQHELVKNEESTVFSQAIHYASLMVYLLIPLDTSKIKLLRSAP
VADWESGSNSIVTNSIAGSVAESFDTESGFEDSENSDVANSVVRFVARFIDKVCTESGVT
QDHIKSLHSMIPGIVAMQMEALEAVHRESRRLPPIQKPKILRPALLPGEELVSEGLRVVL
DPDGREEATGGLSGGPHILPAEGALFLTTYRIIFKGTPHDQLVGEQAVIRAFPIATLTKD
KKISIQNQLQQNMQEGLQLRSASFQLIKVAFDEEVSSEMVEIFRKHLQRIRYPQSIFSSF
AFAAGQTAPQLNLPKQKERNTGFRTLSKTLVKGAKRAGKITMGRGSQTTLKKNDRGSRMT
WHEDDDVSISDDGEPPPSSTLRASEKSTMEQLVEQSCFRDYQRLGLGTITASSSRSKSGE
QFRVTAVNRLYYLCRSYPGLLVVPQAVQDSSLHKVARCYRHNRLPVVCWKHPRTKAVLLR
SGGFHGKSVVGLFKSQNPSSTAPASSSESSSSLEQEKYLQAILNSIPIYFKVNGNNTLSN
RSLQGLSPGMWASLRSSSRLSHHPSTADVGSRRAGKDLAPPAGSVSLQAQLLKRQAALYV
FGEKSHLRGLRVDSSLNCELVPVDFADTRQVKASFKKLLRASAPSATSSDSEDSFLKALE
DSEWILQLHKILQLALILVELLDSGSSVLLSLEDGWDITTQVVSLVQLLSDPFYRTLEGF
QVLLEKEWLSFGHKFSQRSNLSPSSQGGGFTPVFLQFLDCVHQISEQHPLEFEFNQYYLK
FLAYHHISNRFKNFLLDSDYERLEHGTLFEDKGDKQARRGICIWECMNRMHRRSPVFFNY
LYSPTESDAILKPSIGIPSLNKWDYFTDETLSTGPRYDWGMMAARSDSSEEVHTLSNSKR
RIVWPCYSSVSRAQPDAITKLLTDIWKLEGELNQTSEKWQTTLERVRISIQEDLAQLRKQ
STVSISGLIPTPSMQAFQRRSMLHLPDSALGEDHSTSAANGIRRAATLYNQFTPKSEENR
SYEGILYKRGALLKGWKPRWFVLDITKHQMRYYDTGEDTNCKGHIDLAEVESVIIASPTL
GAPKHISEKAFFDLKTSKRVYNFCASDAPSAQLWMDKIQNCISDA
Download sequence
Identical sequences G3PSW5
ENSGACP00000020701 69293.ENSGACP00000020701 ENSGACP00000020701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]