SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020704 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020704
Domain Number 1 Region: 853-994
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000102
Family GRAM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020704
Domain Number - Region: 164-342
Classification Level Classification E-value
Superfamily ARM repeat 0.0622
Family MIF4G domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020704   Gene: ENSGACG00000015683   Transcript: ENSGACT00000020743
Sequence length 1028
Comment pep:known_by_projection group:BROADS1:groupII:10140062:10169070:-1 gene:ENSGACG00000015683 transcript:ENSGACT00000020743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPRRLQPASLFVFGCTQFCQPGGWRLSRERKAPTFFTVVLTDIDSDRHYCSCLTFYEAEV
NLQGSKSIEADGDEDEEAEEDGLIQPAQVFAPKSLILVSRLDYPEIFRGCLGLIYTVHID
SLSFPLESLVANLFAFQVPVAGGSQKLFSLGAGDRQLIQTPLNDTLPITCKSVGLLFQQL
GIQNVLSLFCAVLTEHKVLFHSTSYQRLEEACRALEALMFPLKYSYPYIPILPSRLLEVL
SSPTPFIIGVHSMFQTEIQDLLDVIIADLDGGTIKIPECIHLSPLPEPLLHQTQTSLSLV
LHPDLEIADNAFPPPRTAASNPKLLDKEVRAVFLRLFAQLFQGYRSCLQLIRIHSEPVIH
FHKTAFLGQRGLIENDFLTKVLDGMAFAGFVSERGPPYRACDLFDELVALDTDIFKEEEA
SPAKLQKHIRAFSEQLYRNENPNPHMAFQKVPRPSEGSHMRVHQVPFPLLDDEHVEKMLQ
EGVAKHSSAPASTRPERKCVVPAGPPVVSIMGKSGSVFNSARRLEVVRSCISFIFDNKTL
ETEKALPAALRALKSKAARHCLTEELSLHVQQNRAILDHQQFDHIIRLMNCALQDCSSSE
EYTVAAAVLPLSTAFYRKLAAGVNQFAYTCIQDHPIWTNQQFWEATFYSEVQSQIRALYL
NTPQGKDCITVRLKDAGPEAAAGGAEEHTAMALAAMQLRSWPGLSKEKQHELVKNEESTV
FSQAIHYASLMVYLLIPLDTSKIKLLRSAPVADWESGSNSIVTNSIAGSVAESFDTESGF
EDSENSDVANSVVRFVARFIDKVCTESGVTQDHIKSLHSMIPGIVAMQMEALEAVHRESR
RLPPIQKPKILRPALLPGEELVSEGLRVVLDPDGREEATGGLSGGPHILPAEGALFLTTY
RIIFKGTPHDQLVGEQAVIRAFPIATLTKDKKISIQNQLQQNMQEGLQLRSASFQLIKVA
FDEEVSSEMVEIFRKHLQRIRYPQSIFSSFAFAAGQTAPQLNLPKQKERNTGFRTLSKTL
VKGAKRAG
Download sequence
Identical sequences G3PSW8
ENSGACP00000020704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]