SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020735 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020735
Domain Number 1 Region: 11-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.87e-20
Family Ras-binding domain, RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020735   Gene: ENSGACG00000015714   Transcript: ENSGACT00000020774
Sequence length 421
Comment pep:novel group:BROADS1:groupII:10389728:10390990:-1 gene:ENSGACG00000015714 transcript:ENSGACT00000020774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPAMETEEGQISVWVCREEKLVFGLSKRTACADVVKVLVDEQNAQRGLPDAACPRAYCIV
EKWRGFERTLPSKTKMLRLWCAWGEERSNVKFLLVKSEASLASHGARGAEARVVLSRHRP
RVAKSPEGGIPPGKHRRVVRKAFRKLERINKKRAQRDASSAETIETLVHLVISQDHTMRQ
QLQRITQLDADIEACEAKVHSDRIDKHGVNYVQDTYLVDAARRDGDRVRSAQTVASLEEY
VRRCEQVVRLQEELREKEALVDVFTTQVQQELNRRWMRRRKQLQREDAEPDEAPDAASEK
QLFWEEDRIRTQLEASLYVGLRLNADLDAIGGDLELTREICGAREKEMRDLLEKVKTLEM
EEGSANEERCGPGTDDKMGMTCALEREPEWVAQAGGPSKAHCVDDDDSDTGLSSLHSQDS
D
Download sequence
Identical sequences G3PSZ9
69293.ENSGACP00000020735 ENSGACP00000020735 ENSGACP00000020735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]