SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020786 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020786
Domain Number 1 Region: 376-594
Classification Level Classification E-value
Superfamily Bet v1-like 2.2e-40
Family STAR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 37-118
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-19
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020786   Gene: ENSGACG00000015744   Transcript: ENSGACT00000020826
Sequence length 603
Comment pep:known_by_projection group:BROADS1:groupXIV:798032:808867:-1 gene:ENSGACG00000015744 transcript:ENSGACT00000020826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLRHPELELSGPEEDGEPRDESGTLVAGGTQSGVSSKWTNYIHGWQDRWVVLKNNTLSYY
KSQNETEYGCRGSLCLSKAVVTPHEFDECRLDISVNDSVWYLRAQDPEHRHQWIDSVELH
RADSGYGSESSLRRHGSMLSLTSATSGFSATSSSSFKKGHSLREKLAEMETFRDILCRQV
DTLQKYFDGCSDAVSKDELQRDKIVEDDEDDFPNTRTDGEFLHNNHGSKEKLFQAVSPKG
INGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKRVDKEMEKRRRIEEGYKSAL
NDMKKKSHLRGPDYEEGPNSLINEDEFFDAVEAALDRQDKIEEQSHTEKIRLHRSSPVPP
GDIYSSIGTHRFSEKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVL
DPLKATHSVKGVTGHEVCHYFWDTAYRNDWETTIENFNVVETLSENATVVYQTHKRVWPA
SQRDVLYLSAMRKILANNENDPDTWLVCNFSVDHDDAQPPGRCVRAKINIGMICQTLVSP
PEGDKEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKP
ILF
Download sequence
Identical sequences G3PT50
69293.ENSGACP00000020786 ENSGACP00000020786 ENSGACP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]