SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020801 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020801
Domain Number 1 Region: 714-775
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000622
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020801   Gene: ENSGACG00000015765   Transcript: ENSGACT00000020841
Sequence length 1144
Comment pep:known_by_projection scaffold:BROADS1:scaffold_135:25119:29644:1 gene:ENSGACG00000015765 transcript:ENSGACT00000020841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKKDKRILSGTCPDPKCQARLFFPAHGSVSIECTECGQRHEQRHLLNVEEVTDPDVVLH
NLLRNALLGVTGAPKKGTELVKVMGLSNYHCKLLSPVLTRYGMDKQTGKAKLLRDMNQGE
MFDCSLLGDRAFLIEPEHVSTMGYGKDRSGSLAYLHDTLEEVKKANGGGECLIPVHVDGD
GHCLVHAVSRALVGRELFWHALRENLKQNFKQNVDRYKALFQDFIDAAEWEDIINECDPL
FVPPEGVPLGLRNIHIFGLANVLHRPIVLLDSLSGMRSSGDYSATFLPGLVAEERCRGRD
GTLNKPICIAWSSSGRNHYIPLVGIKNAVPPKLPARLLPKAWGVPQELIRKYVELEPDGG
CVIGGDRSLQDKYLMRLVNAMEEVFMEKHSIHPSLVADVHQYVYRRTGVIGVQPEEVTEA
AKRSVTENRLHRCLICGALSELHVPPEWLVPGGKLYNLAKSTHGQLRPDKNYSFPLNNVV
CCYNPQRDVLAPDYKLSSLATCNWCHGTSVRHVRGDGAVVYLDGDRTNARSQGGKCGCGF
KHHWEGKEYDNLPEAFPITLEWGGRVVRETVYWFQHEVEPALNSNVYDVAMKLVTKHFPG
EFGSEILVQKVVNTILHHTAKKNPDEYNPVSIAGAHDQRLTDATETPPPEARTPPTKIIL
TGQKAKTLHREELTMSRAERGVQQSIGEQAPVNQKRRTDRLRQEEEKSRTSVPETSSSAP
ATPTTPSNKEKKIRVTTSDGRQAMLTLPVHTTFSELQRSVAEQFGVPPARQCIRHGFPPR
ELPPPKDGEENEPTALQHGDRVTVEILKAPEDEGPAPSAATAPRASGSHAAPPGRASSRG
LQEGIDLEMSSLCLLATLMGEDVWSYAKKLPHLFQQGGVFYNIVKKDMGLMDGKHCTLPH
LTGKTFVYNAAEARLELCVDAAGHFPVGPDVEELVKEVLVQLRSDGTTRGSREGSPSHGL
LRLGGGGVVHKKERLQSVTAFQGKGHSLGSAGGSSPPEHRPITRQHSSGVDLSASVSRDP
PDLSDIPEDATRELVRMAPGFVTTKEGRGLDPGLMEQQRRKLQEMVSSIQASMERHLREQ
QSDAAAGGGTKTGAGQPPSTLVVEEEQRPPAAVPGKPEGKGAEPEEMESQDGEQTNATEP
MDHS
Download sequence
Identical sequences G3PT65
ENSGACP00000020801 ENSGACP00000020801 69293.ENSGACP00000020801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]