SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020834 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020834
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily PH domain-like 5.82e-49
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000398
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020834
Domain Number - Region: 185-320
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00034
Family HBL-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020834   Gene: ENSGACG00000015784   Transcript: ENSGACT00000020874
Sequence length 356
Comment pep:known_by_projection group:BROADS1:groupXIV:1072364:1079232:-1 gene:ENSGACG00000015784 transcript:ENSGACT00000020874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDNTRNVYRIISLDGTKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSESNLAKFAEKFAEFKEAARLAKEKSQEK
MELTSSPSQESAPGDLLSPLTPESINGTDDERVRPVTPQHAEPRAEPSQNALLFSQSSSN
INKHWEAELEALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSGQ
TTVIKSQKTELNQTIEELESALRAKEEELERLKAEVESTNDFRSQKDFLTQKLQHTESMN
QALEARLSDLERRLQSNQQEREAFRRSLRQLLELLDGKLFELTELRDALGRIVESS
Download sequence
Identical sequences G3PT98
ENSGACP00000020834 69293.ENSGACP00000020834 ENSGACP00000020834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]