SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020839 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020839
Domain Number 1 Region: 478-766
Classification Level Classification E-value
Superfamily L domain-like 1.04e-40
Family Leucine rich effector protein YopM 0.014
Further Details:      
 
Domain Number 2 Region: 776-1033
Classification Level Classification E-value
Superfamily PP2C-like 1.83e-34
Family PP2C-like 0.0051
Further Details:      
 
Domain Number 3 Region: 245-489
Classification Level Classification E-value
Superfamily L domain-like 3.4e-32
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 4 Region: 139-239
Classification Level Classification E-value
Superfamily PH domain-like 0.00000139
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020839   Gene: ENSGACG00000015791   Transcript: ENSGACT00000020879
Sequence length 1310
Comment pep:known_by_projection group:BROADS1:groupII:11127315:11148839:-1 gene:ENSGACG00000015791 transcript:ENSGACT00000020879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNGSRGCVTRKNRFGSRERDWLKGDTQRGCVCLYGGTVDPQPPASGPQASSTPQTDLQ
LVLCSTTTTVEELCAQRDGHGLYVQLHGDLVRRLDPTERPLQMLYDYLAAMGYAEPVRVQ
QEAANSDLSCLIRFYSEPPVNADQQERTLLKGIFNVRKGKSQLHKWAERQVILCGTCLIV
ASVKDSLTGKMHILPLVGGKVEEVKRRQHCLMFSSAGSQAQTYFVNFDALADYQRWHRQA
SKVVSQTVSLVDLSCYSLEVVPEYLFYSQDITHLNLRHNFMSLQGPGGLLNLPKFSQLKS
LNLSHNRLGVFPECVCEILTLTELNLSCNSLLTVPVQIGNLQSLQILSLDGNHLSSLPED
LGGLSQLNSLGLSFNNFSHIPAVLERLSAVDKLAMAGNTVESLELCTLARMSHLKNIDLR
LNRLHCVKSESLEAVSQVTQLDLRDNCLDSLDLSSVCNLETLHCQRNQLGTLTLSGFTLR
MLHASSNRLPTVNIYPVPNQLTSLDLSQNLLEYLPDWVCDCRKIEMLDVTHNLLSELPSR
LLNSLSLRKLLAGNNCLQRVPDLLDHIPLEALDLQHNKLAELPESLFYKALNLKYLNVSA
NALDSIPPSSPSEESLSTLQELYLTANHLKENCGALLVGHQNLRVLHIAYNQLLSFPASK
LSKLEMLEELNLSGNKLKAIPSTVSSCKRLHTLIAHSNHITVFPEILNLPEIKLVDLSCN
ELTEIQLPDSLPSTLQELDLTGNSSLMLEHKTLNLFSHITTLKLDQKSTTSVGDSQSGST
PWNHGYSEMSGQRNKDRLCVSVLAVDRFGDGVEACYGIFDGDRNEEVPRLLQCTMGDVLC
EELQHSSIDSVYMCNTFLTSHRKLGMAGQKLGASALLCYIHHEPSDPGSYFSLTVANVGT
CQAVLCRDGRPVPLSKVYSLENSTEEMERVKLSKAIITEDNKVSGVTCCSRLLGCSYLSP
WVLPKPWVHTEPLCTKDEFLILGNRALFERVSYQEAVCTVQAVRDPRAAAKKLCSLAQSY
GCKDNIEAAVVSLHIVEDSCTCEPPVPSTEPRCPPPIATVTPGPTDPVAPSSNCGIVSEC
NGEASTSEVGGEAGSTAPDEHPSSVLASRPERRCSLHPATTLCGIMVPGAVGAGTHLGLF
QRQPSCTTFSSNHSDNGLDSDDEAPLEGVISNGSKLEVEVDIHCCAFQLRSGAPESSKDL
ELKKRGSDYPNGKMRRQNSVVVSATNGCLLAVCGREIADLKKSPSTSSLFGKKLSNGSVV
APEDSHNLIEVALEAPKKKSGYFTAPAQQDPEDQLIVPPSLEQEVREQLR
Download sequence
Identical sequences G3PTA3
ENSGACP00000020839 ENSGACP00000020839 69293.ENSGACP00000020839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]