SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020848 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020848
Domain Number 1 Region: 206-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.61e-94
Family Myotubularin-like phosphatases 0.00000436
Further Details:      
 
Domain Number 2 Region: 38-181
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-22
Family GRAM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020848   Gene: ENSGACG00000015799   Transcript: ENSGACT00000020888
Sequence length 764
Comment pep:known_by_projection group:BROADS1:groupII:11195298:11205427:-1 gene:ENSGACG00000015799 transcript:ENSGACT00000020888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVKPTKPTFRSYLPPVQTDVKKTIESPPKKVEPKLLQAGEIVVNEVNFVRKCLSADSS
QEGLWGKLICTNFKVSFIPTDPPSEQKSHLSHLLLGLHDIPLTCLEQVVTVNDTKGKKKV
LGSNQKLKFNPTELILYCKDLRIIRFCFVEAGPESAKKVCLAIAHYSHPADLPLLFGFEY
QGRRYHDSKGQRVNDRGGLRTPIFDRPSDWDREIKRTGASEWRVCSINENYAISPSLPEH
IVVPVSLADQDLKQNSIYFMNQRIPVWCWNHPNGSALVRMASIADPLQQRRIDQRFIPAI
TKSHPQRSEVIRSDLDKCLPNIQDLQSAFIKIRHICVIDSFEESEERWLSSIENTRWLEY
VRAFLKHSAEMVYLLDGKNTSVILQEEEDRDLNCVVSSLVQLMLDPHYRSLVGFQSLVQK
EWVMAGHRFLDRCNHLKKNDKDESPLFMLFLDCVWQVMNQYPAAFEFTETYLTVLSDSMW
IPLFSTFLFNSPKQRAQYLMDFAKNKAIPQGEDQLVYFPPVWDWSQQYSTADQTLFNNPM
FVGKGAACVQNGEVKTFRRTKKTYSATVRGTHASLRNGQKGGEDSLARRGSLLSELKPDF
SLVKDESPSERFFRDWFSRPADQQSLLIPLLIPSHLALWKLYFLRWVPEACIFKGGPITA
YHKLSQLVDEIEILQSHLRQYKGTRESGSTQLPGLSGPFSSQRRMYFKASSLQDPPSPPD
FLTSSFPFTPSGNLCRRSTYGTPISKFLNGARIWLSTETLDNDP
Download sequence
Identical sequences G3PTB2
69293.ENSGACP00000020848 ENSGACP00000020848 ENSGACP00000020848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]