SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020926 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020926
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 2e-35
Family Phosphotyrosine-binding domain (PTB) 0.000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020926   Gene: ENSGACG00000015854   Transcript: ENSGACT00000020966
Sequence length 592
Comment pep:known_by_projection group:BROADS1:groupXIV:1628593:1634822:-1 gene:ENSGACG00000015854 transcript:ENSGACT00000020966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTMSAEVESSAPLPAEPGIASPPAASAATPPTSPATATSKVPFRKEKKKVSEKTDEYLLG
RFQGDGVRYKAKLIGVDDVQDARGDKMSQDSMMKLKGMAVAARSQGKHKQRIWVNISMSG
IKIIDEKSGVIEHEHMVSKISFIARDVTDNRAFGYVCGAEGQHQFFAIKTAQQAEPLVVD
LKDLFQVIFNVRKKEVEASQKGENGSTVVENGSGASPGVAAEVKAAQPVEQLDLFGAMST
PPDIQSPNSTVSDLFGAELFSAPVHSEGSSSSGDFFNSTTPPSIAALAGNLQLGPSASMG
VPAAGVWGASMAPPSMFPLQGVPAPGPRPAYPQQSAFGGVPAPPAVWGAPVRPQFGAAPL
SPPHLNWGQPPPAGAPGWGQPVMSNPFQPVPFPALGDHQGPSRPPPRPPGKEAPAQVENS
AFTALDPLGDREKKMGKDMFKDFQIAKPPAIPARKGELAAAGPGSGDAGAFDQYFNSKVG
LAQDTADHDDFDINQMSAVVNGNQTDILSTCRFPKLAPAPAAAPSFNPGLLNAAFSAAPI
ASNSAPAQGLGQDMFDNAFGSPESSLFGAPPAVMPTAAVGQSFGDPFGNPFA
Download sequence
Identical sequences G3PTJ0
ENSGACP00000020926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]