SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021016 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021016
Domain Number 1 Region: 60-314
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.28e-40
Family PhyH-like 0.052
Further Details:      
 
Domain Number 2 Region: 869-926
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.35e-21
Family Tudor domain 0.0005
Further Details:      
 
Domain Number 3 Region: 927-982
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000129
Family Tudor domain 0.00037
Further Details:      
 
Domain Number 4 Region: 698-745
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000179
Family PHD domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021016
Domain Number - Region: 789-840
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0377
Family PHD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021016   Gene: ENSGACG00000015922   Transcript: ENSGACT00000021056
Sequence length 1044
Comment pep:known_by_projection group:BROADS1:groupIX:432073:452261:-1 gene:ENSGACG00000015922 transcript:ENSGACT00000021056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEVYTPANPTCKIMTFRPTMEEFKDFNQYLVYMESQGAHRAGLAKVIPPKGWKPRRT
YDDIDDLMIDAPIQQMMAGQSGLFTQYNIQKKPLSVQEFRRLANSDMYCTPRYLNYEDLE
RKYWKNLTFVSPIYGADVSGSLYDEDVEEWNIGHLNSILDVIEEDCGVSIQGVNTPYLYF
GMWKTTFSWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLATGFFPNSFKGCEAFL
RHKMTLISPSILKKYGIPFDKITQEPGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVATQCTCSKDMVKISMEPFVKRFHPDRYANWMAGKDSAPPDHILATPSTTPELQSWL
QSRRKTKPANKRYAVFRSLRRAVKEKEEEEKEKKREAQSKHTPNHSSAHLSGPCRQMCVV
KVNRVESNSLGLLNTEPSHDSRCLSGASPASALTKDLKAETGARDDPLRRSGSGVATPEG
LARTQPKNNEPRCCSPERRDLCTSQDSSNNEEEENDTSNCECEESGLEPGEVCAVSALYY
THSFSYNYSALSVKRTTKSRRHPLRKPTARAVPTAVKQQAASDDGHWGEVVTTVEGLDQN
LAAMEAWAKPLIYLWQNRKSCFTAEREFNAHAATMRPHCAVCTLFSPYEQGSSSPSEGPA
RPCRGLRRTRPLVPEICFSFREQNFPPTPTNPLLQEDGTSPLLYCQGCCLQVHASCYGVA
AADLSEQWSCDRCAEGSFTAECCLCNLRGGALKKTQSDNRWAHVMCAVALPEARFSNEAK
RSPIDTSGIPMQRYKLKCIYCGARGSGKRRPGACVQCSCGRCPTSFHVTCAHAAGVIMEP
DDWPYVVSITCHRHQSRSSAAKQRACQAPVSLGQTVICKHKNLRYYSSKVTQVTSQTFYE
VMFDDGSFSNDTYPEDIVSRDCMDLGPPEVGEAVQVKWPDGLFYGAKYLGSNVSHMYQVE
FEDGSQVLAKREDVYTVEEDLPKKVKRRLSSASSMRFQDAFFTTQGERKRQRTPNSRFQK
DYVALPGLRGAAKSSWEQRGHKGN
Download sequence
Identical sequences G3PTS9
ENSGACP00000021016 ENSGACP00000021016 69293.ENSGACP00000021016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]