SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021017 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021017
Domain Number 1 Region: 37-110
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000332
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021017   Gene: ENSGACG00000015924   Transcript: ENSGACT00000021057
Sequence length 147
Comment pep:known_by_projection group:BROADS1:groupXIV:2535822:2541744:1 gene:ENSGACG00000015924 transcript:ENSGACT00000021057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSNVQGGKAFGLLKEQQRSKLEEINKEYLEDQKYRDEEDLPQKLEGLKNKYSEFDLNDQ
GEIDMMGLKRMMEKLGVPKTHLELKKMIVEVTGGGSSNTIDYRDFVKMMLGKRSAVLKLV
LVFEDKANGATCKPDGPPPKRDISSLP
Download sequence
Identical sequences G3PTT0
69293.ENSGACP00000021017 ENSGACP00000021017 ENSGACP00000021017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]