SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021051 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021051
Domain Number 1 Region: 129-187
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000144
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021051   Gene: ENSGACG00000015953   Transcript: ENSGACT00000021091
Sequence length 440
Comment pep:known_by_projection group:BROADS1:groupII:11987108:11994055:1 gene:ENSGACG00000015953 transcript:ENSGACT00000021091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDERLANFRQTRLNPFDRGEEEDGLHGGKTPPLREKPESKPELFSGTRTHSSDRTMDL
GLAEDHFSRPMGSIVASDIEQLKMAIEECKKLILELPEHSERQKDTVVKLIHLRLKLQEL
KDPEEDEPNLRILLEHRFSKEKSKSVKQTCDKCSTIIWGLIQTWYTCTGCYYRCHSKCMN
LITKPCVRSKVSHQSEYQLSICPEIGLDRQDYRCAECRTPISLRGVPTEARQCDYTGQYY
CSTCHWNDTAMVPARVIHNWEFESRKVCRSSMRYLALMISRPVLKLKEINPLLFNFVEEL
VEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDDMYSLQDLIDISSGRLSC
SLTEIHTTFAKHIKLDCERCQAKGFVCELCKEGDILFPFDSHTSVCHDCSAVFHRDCYYD
NSTTCPRCARMTDRKQDEEP
Download sequence
Identical sequences G3PTW4
ENSGACP00000021051 69293.ENSGACP00000021051 ENSGACP00000021051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]