SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021130 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021130
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021130
Domain Number - Region: 454-511
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021130   Gene: ENSGACG00000016012   Transcript: ENSGACT00000021170
Sequence length 547
Comment pep:known_by_projection group:BROADS1:groupIX:803550:808430:-1 gene:ENSGACG00000016012 transcript:ENSGACT00000021170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSALELSCQKGWMSILDAHGRWQKLWFVLGDTSLRYYRDADAEEADDVEGEINLICCINV
AECDVEKNHGLQIQTKRALFTLSVMTSRIRRNWVKLLKQAIQNNTQCVTLPTCLSLAATS
ANRTPAARKTTPSPGDRRHANPPLASPARTPAMNLPADHHHTVDLDLDLSPSSQREEGEG
WDREQAKRLEERNKWFEEGVPFSEMGSRWDSMALKRGSAPGHLNETLDSDVSSKWVEFET
FPCRNGEQTDKGAALQKEALSLRKQVESLQGERAASGVEVDSPCGPGAPCRARLVAMEEA
HRKALQEQQEKHAREIAELQEQRDRLLREESQAAAEAVEAVRAAHREELEREVEKARSLA
GGAAHADAPHGGHMPQADASRSELDVLSERYGQRCLELRHGEQSGRGREAELGLKERELQ
QLRRENQDLKVKLAEEISRMRYFITGLRSDTASLGNAERAASELETLLRAKDNEVQYLKK
EISCLQNEVQSLTKEKSAAYERYKEAYVVLSDTRGRGQLKTSSLTEHLKLANAALQEGAG
KQDSVGE
Download sequence
Identical sequences G3PU43
ENSGACP00000021130 69293.ENSGACP00000021130 ENSGACP00000021130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]