SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021178 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021178
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000000138
Family TAP-C domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021178   Gene: ENSGACG00000016043   Transcript: ENSGACT00000021219
Sequence length 257
Comment pep:known_by_projection group:BROADS1:groupIII:9217885:9220909:-1 gene:ENSGACG00000016043 transcript:ENSGACT00000021219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLKSSQKDKVRQFMIFTQSNEKTALTCLSQNDWKLDVATDKFFQNPELYVSNLKGALD
KKKLDQLYNRYRDPHDDNKIGIDGIQQFCDDLALDPASISVLLIAWKFRAATQCEFSKLE
FMDGMAEQGCDSIEKLKAQLPKMDQELKDQGKFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLAGRFKFLELWNKFLVEHHKRSIPKDTWNLLLDFSTMITDDMSNYDEEGAWPVLID
DFVEFARPHIGTKSTAV
Download sequence
Identical sequences G3PU91
ENSGACP00000021178 ENSGACP00000021178 69293.ENSGACP00000021178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]