SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021206 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021206
Domain Number 1 Region: 700-1060
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.98e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000574
Further Details:      
 
Domain Number 2 Region: 524-696
Classification Level Classification E-value
Superfamily ARM repeat 1.09e-61
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000245
Further Details:      
 
Domain Number 3 Region: 106-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-47
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 4 Region: 331-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.14e-41
Family PLC-like (P variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021206   Gene: ENSGACG00000016071   Transcript: ENSGACT00000021247
Sequence length 1068
Comment pep:known_by_projection group:BROADS1:groupIII:9263619:9271990:1 gene:ENSGACG00000016071 transcript:ENSGACT00000021247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRPSSGELWGMHLMPPSILVDCLLPNGMILTLECLREATLVTVKHDLFKEARKYPLHH
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDSEVQDFRRNILNVCKEAVDLRDSNGPHSRALYVYPPNVESSVELPRH
IYNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPID
NFTMPSYARRISTATPYMNGETATKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTLRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SCPVKYPEMTIIEEHANWNISRELGFNYCHTGLSNRLARDNPLTDTDNEQLRQVCNRDPL
SEITEQEKDFLWRHRQDCVNMPEILPKILLAVKWNSRDEIAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKRALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGIKGALQFNSHTLHQWLKDKNKGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
Download sequence
Identical sequences G3PUB9
ENSGACP00000021206 69293.ENSGACP00000021206 ENSGACP00000021206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]