SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021272 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021272
Domain Number 1 Region: 209-230,312-423
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-28
Family Phosphotyrosine-binding domain (PTB) 0.0085
Further Details:      
 
Domain Number 2 Region: 16-161
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000752
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021272   Gene: ENSGACG00000016125   Transcript: ENSGACT00000021313
Sequence length 706
Comment pep:known_by_projection group:BROADS1:groupIX:1575823:1593458:1 gene:ENSGACG00000016125 transcript:ENSGACT00000021313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRRLSSCGGKVEEEAEEEVDYRLTLIGSLPVHHLTTMAMLPWVVAEISRCAQRSAGPVPH
SGGPSGPSSLNQSVFLCVSASRVRCVCVLAEGGGWDPLTRTVLFECRPHQVTKLIHNSQE
PGGFGCLVREGASCTCYVFRGQDSTKVPEIISTLRQAGKSSARSDVIAPVSVKTTSGGHD
PPEACHSSVSAKATSTAASAVISPTAFAKKFEVLFCGRASVAHKKAPPALIDECIEKFGQ
LHGSGASEEGATARGSAGAPQRASFQPNGLGGADVRNGAAGSPTAGKRPALFKGDPSFPC
LQALDENGLSPEISHTNTTEAHSAGVQPTSLQENRTMLFMVGRSQIFLVSPDTKKVAIEK
SFREISFCSQGIRHVDHFGFICRETVEGGSCHFVCYVFQCTDESLVDEIMLTLKQAFSVA
AVQQNMKNQRQQCDSCPMQQLHRLCERIEGLHASKTKLELQRHLATLDNEEQASVFENTM
RACPKSDQEENELVMAYLRVLYEEKQRSHQHALPGDIKQEAAPAPVDSQQSSSRQRLEQF
KSRAKRSLTESLEGIWKGSSKARAQRDNSVGGDGASSVCALDSNQDQSCLDDPLPAPSQL
RPTSPLRYHNSTGNLKRLDSSLPPSPSASSQPGDAHPPGFRRRASTFSHPPTPSSADNSP
LHALTRTPQDHASASKPKLVRHYSVSTDTPHQSNVNSSVLEKRSKC
Download sequence
Identical sequences G3PUI5
ENSGACP00000021272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]