SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021273 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021273
Domain Number 1 Region: 33-197
Classification Level Classification E-value
Superfamily RUN domain-like 3.27e-50
Family RUN domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 562-628
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021273
Domain Number - Region: 353-471
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021273   Gene: ENSGACG00000016120   Transcript: ENSGACT00000021314
Sequence length 632
Comment pep:known_by_projection group:BROADS1:groupII:13504332:13521831:-1 gene:ENSGACG00000016120 transcript:ENSGACT00000021314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSPQSLHRWGITHSESMERLAYSHALRDPMAMERANLLNMAKLSIKGLIESALSFGRTL
DSDYPPLQQFFVVMEHCLKHGLKVKKSFLGFNKSLWGPLELVEKLCPEAVEISASVRDLP
GLKTPLGRARAWLRLALMQKRLADYLRLLITRKDLLSDFYEHSALMLEEEGAVIVGLLVG
LNVIDANLCVKGEDLDSQVGVIDFSMYLKNDIDDYRSEERNSQISSILDQKNYVEELNRQ
LNSTVGGLQGRVDSLEKSNSKLVEELAIAKNNIIKLQEENQQLRSENSLILQKTQEHLEV
TQGDASVERDTYKQSRQGLDEMYNDAQRQLKEECQHRQDVENELVVQMSMKQEMELAMKL
LEKDIHEKQDTLIGLRHQLDEVKVINVEMYQKMQSSDEEMKKKNDVITRLEEKTNQITAT
MKQLEQRLQEAERHRTSAEEGTRRFKLDFANKADSLQRQIEHRERQLQQLETDLKIEREW
RQTLLNDLERERDTVAQLSTEALQINGLKKEFHRLHDENVQLKTICEDQEQALEELGSKL
SESKMKIEDIKEANKALQGGQVWLKDKDASHCKLCEKEFSISRRKHHCRNCGEIFCNSCS
DNELPLPASPKPVRVCDTCHALLLQRCSSNPT
Download sequence
Identical sequences G3PUI6
ENSGACP00000021273 ENSGACP00000021273 69293.ENSGACP00000021273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]