SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021274 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021274
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily RUN domain-like 3.14e-50
Family RUN domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 549-615
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.59e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021274
Domain Number - Region: 340-458
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 237-330
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021274   Gene: ENSGACG00000016120   Transcript: ENSGACT00000021315
Sequence length 619
Comment pep:known_by_projection group:BROADS1:groupII:13504332:13518151:-1 gene:ENSGACG00000016120 transcript:ENSGACT00000021315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPRRTAARTKPALRDPMAMERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVV
MEHCLKHGLKVKKSFLGFNKSLWGPLELVEKLCPEAVEISASVRDLPGLKTPLGRARAWL
RLALMQKRLADYLRLLITRKDLLSDFYEHSALMLEEEGAVIVGLLVGLNVIDANLCVKGE
DLDSQVGVIDFSMYLKNDIDDYRSEERNSQISSILDQKNYVEELNRQLNSTVGGLQGRVD
SLEKSNSKLVEELAIAKNNIIKLQEENQQLRSENSLILQKTQEHLEVTQGDASVERDTYK
QSRQGLDEMYNDAQRQLKEECQHRQDVENELVVQMSMKQEMELAMKLLEKDIHEKQDTLI
GLRHQLDEVKVINVEMYQKMQSSDEEMKKKNDVITRLEEKTNQITATMKQLEQRLQEAER
HRTSAEEGTRRFKLDFANKADSLQRQIEHRERQLQQLETDLKIEREWRQTLLNDLERERD
TVAQLSTEALQINGLKKEFHRLHDENVQLKTICEDQEQALEELGSKLSESKMKIEDIKEA
NKALQGGQVWLKDKDASHCKLCEKEFSISRRKHHCRNCGEIFCNSCSDNELPLPASPKPV
RVCDTCHALLLQRCSSNPT
Download sequence
Identical sequences G3PUI7
ENSGACP00000021274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]