SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021279 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021279
Domain Number 1 Region: 16-177
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-37
Family Phosphotyrosine-binding domain (PTB) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021279
Domain Number - Region: 277-353
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021279   Gene: ENSGACG00000016130   Transcript: ENSGACT00000021320
Sequence length 533
Comment pep:known_by_projection group:BROADS1:groupIII:9537847:9551456:1 gene:ENSGACG00000016130 transcript:ENSGACT00000021320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVTKYNLVDDAHDLRLPMHNDEVFKHGVCFEAKYIGSLEVGRPGSRMEIVAAMRRIRY
EFKLKNIKKKKVNIVVSTDCVKVILRKKRKFLLVFQQRKGWSWDDSTVLLTQDPIYRIFY
VSHDAQDLKIFSYIAREGQSSIFRCNVFKSKRKSQAMRIVRTVGQAFDVCHQLTLQQKSD
DQEDEEGKAEDSEAVPAKKRFALSEGADLEATTEESIECVSSSGLEKSKKDEALGNNEKK
YPGNKSWSSVLHSQVPGDPSLLLDSLILAASVSGLSVEEAPCSAEHQVQLLQKQLQQQEQ
QALAASEQVHVLQEQLSVELCARTETQARVQRLLQQNTDLLQHISLLVKQIQELELKAAG
QSSVGSQDSLLEITFRPKPPSSTSFTGPFSAPSQVQISDSPWVSALLGPRSPGASGADTG
PLELSGSGVRLECFRFTSRGPDLQEHGRDAGETPGDGGPDGSPLLGDQVLGALELLRFRE
SGIGSEYESNTDESDDRDSWGQGEGSGSDGAARLLNVLNAECLADCLGDEMAV
Download sequence
Identical sequences G3PUJ2
ENSGACP00000021279 ENSGACP00000021279 69293.ENSGACP00000021279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]