SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021322 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021322
Domain Number 1 Region: 351-409
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000377
Family PHD domain 0.0066
Further Details:      
 
Domain Number 2 Region: 298-360
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000131
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021322   Gene: ENSGACG00000016158   Transcript: ENSGACT00000021363
Sequence length 426
Comment pep:known_by_projection group:BROADS1:groupII:13621416:13627602:-1 gene:ENSGACG00000016158 transcript:ENSGACT00000021363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEQVSEYLGVTSFKRKYPDMERRDLSHKEKLYLREQNVITETQCTLGLTALRSDEVID
LMIKEYPAKHAEYSVILQERERQRIAKEYSVSINVFHASPPNACVIKLLKQMQQQNSQKV
EASKVPEYIKKAAKKAAEFNINFNRERMEERRAYFDLQTHIIQVPQGRFKVLAPELTKSG
PYPVALIPGQFQDYYKRYSPNELRYLPINTALFEPPLDPELPALDSEPDSDDQEDGKADK
KNKNSSDSSSGNTSDVESQEGGGKPGNKSKAKDRTSTAAKDGGQRHSASHKTPPGYKPKV
IPNAICGICQKGKEANKRGRPEALIHCSQCDNSGHPSCLDMSKELVGVIQTYRWQCMECK
TCIVCQQPHHEDEMMFCDKCDRGYHTFCVGMDSIPTGLWVCEVCEKDCPTPKKKGGAKTP
KKSKSA
Download sequence
Identical sequences G3PUN5
ENSGACP00000021322 ENSGACP00000021322 69293.ENSGACP00000021322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]