SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021324 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021324
Domain Number 1 Region: 331-389
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000332
Family PHD domain 0.0066
Further Details:      
 
Domain Number 2 Region: 278-340
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000122
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021324   Gene: ENSGACG00000016158   Transcript: ENSGACT00000021365
Sequence length 406
Comment pep:known_by_projection group:BROADS1:groupII:13621416:13627522:-1 gene:ENSGACG00000016158 transcript:ENSGACT00000021365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEQVSEYLGVTSFKRKYPDMERRDLSHKEKLYLREQNVITETQCTLGLTALRSDEVID
LMIKEYPAKHAEYSVILQERERQRIAKEYSQMQQQNSQKVEASKVPEYIKKAAKKAAEFN
INFNRERMEERRAYFDLQTHIIQVPQGRFKVLAPELTKSGPYPVALIPGQFQDYYKRYSP
NELRYLPINTALFEPPLDPELPALDSEPDSDDQEDGKADKKNKNSSDSSSGNTSDVESQE
GGGKPGNKSKAKDRTSTAAKDGGQRHSASHKTPPGYKPKVIPNAICGICQKGKEANKRGR
PEALIHCSQCDNSGHPSCLDMSKELVGVIQTYRWQCMECKTCIVCQQPHHEDEMMFCDKC
DRGYHTFCVGMDSIPTGLWVCEVCEKDCPTPKKKGGAKTPKKSKSA
Download sequence
Identical sequences G3PUN7
ENSGACP00000021324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]