SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021357 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021357
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily UBC-like 1.75e-48
Family UBC-related 0.000000154
Further Details:      
 
Domain Number 2 Region: 160-201
Classification Level Classification E-value
Superfamily UBA-like 1.02e-19
Family UBA domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021357   Gene: ENSGACG00000016184   Transcript: ENSGACT00000021398
Sequence length 203
Comment pep:known_by_projection group:BROADS1:groupIX:1738820:1741663:1 gene:ENSGACG00000016184 transcript:ENSGACT00000021398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGFRGGRFQ
LEIKIPETYPFNPPKVRFISKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALL
AAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSSADYNRKIDKLCAMGFDKN
AVIAALSSKSWDVETATELLLSN
Download sequence
Identical sequences G3PUS0
ENSGACP00000021357 ENSGACP00000021357 69293.ENSGACP00000021357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]