SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021393 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021393
Domain Number 1 Region: 551-683
Classification Level Classification E-value
Superfamily PH domain-like 4.47e-41
Family Phosphotyrosine-binding domain (PTB) 0.00000241
Further Details:      
 
Domain Number 2 Region: 362-527
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-32
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 3 Region: 266-303
Classification Level Classification E-value
Superfamily WW domain 0.00000000264
Family WW domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021393   Gene: ENSGACG00000016213   Transcript: ENSGACT00000021434
Sequence length 733
Comment pep:known_by_projection group:BROADS1:groupIX:1972950:1987269:1 gene:ENSGACG00000016213 transcript:ENSGACT00000021434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDVANRNCAAATPPTSLSLRSSHNQLLSAGDAVRQGSATPPKCRKKYAHTSIQAAMGL
GEAAPPSSSSSSPSSPPVSPTPSNPKLAKNGVNQLRKASRDHNKNATDPEPEAAADELNV
NAAEEEESHALTNNDLELISNAEPEQKSESDMDCDVSAPAELQKLDISPGAELISDLRSN
LKLLRSGGKDSPMPPPPSPPKHASPEDAPLLSASPETKKDRRTGAKTDCALNRIQNLNPS
DEELSWTTLSQESHSPEETGTRPIWSEQSVQKDTDLPPGWKKNTDMGGVYYWHIPTGPTQ
WEQAASASRKHFPGSLSPSPTPDHEKRVWSDFGGKIDSEVWKDLQAATVNPDPSLKEFEG
ATLRYASLKLRNRPAVEDEQSSSANRDPETKCFAVRSLGWVEMAEDDLAPGKSSVAVNNC
IRQLSYCKNDIRDTVGIWGEGKDMYLVLENNMLNLVDPMDRGLLHSQPIASIRVWGVGRD
NGSLRDFAYVARDKNTRILKCHVFRCDTPAKAIATSLHEICSRIMTERKNAKAMAGSLQD
RMQAGLDLPLQAEFPTPKTELVQKFQVLYLGMLPVARPIGMDILNGAIDSLIGSSSREDW
TPVALNVADATVTISKDQNEEDVLVECRVRFLSFMGVGRNVHTFAFVMDAGGHRFDCHVF
WCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKACGSLPPADSVSRRVSTSVKRGVLSLI
DTLKQKRPVGELP
Download sequence
Identical sequences G3PUV6
ENSGACP00000021393 ENSGACP00000021393 69293.ENSGACP00000021393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]