SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021440 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021440
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-29
Family Phosphotyrosine-binding domain (PTB) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021440   Gene: ENSGACG00000016254   Transcript: ENSGACT00000021481
Sequence length 306
Comment pep:known_by_projection group:BROADS1:groupIX:2157652:2159226:1 gene:ENSGACG00000016254 transcript:ENSGACT00000021481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENQIYASADEASQFLVTVQKTDAATRCGLKGSYWLQVGREALLLRETQKKNIVREWSY
ELLRRYGKDKLAFTIEAGRRCDSGPGTFTFETPQAEKIFSSIRATINQKSSTTSLGNPNQ
EGENVLAAKIQAHSPLPKIPDATGIAAILENKLRIKGKASAASQESAQEDLAGSSESVSV
QPAPITLMPLPLVPTYGSRSGGGLGGQSEAVYADPADCIQSVTKAKPSVAVYVDPAGVLP
LKPPGTPCTDTLAPPPSDPSDHPDPVYSEVYDKISPVQIERTEIQRNAKIECVASDEPIY
SEPMAK
Download sequence
Identical sequences G3PV03
69293.ENSGACP00000021440 ENSGACP00000021440 ENSGACP00000021440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]