SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021470 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021470
Domain Number 1 Region: 112-159
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000207
Family UBA domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021470   Gene: ENSGACG00000016271   Transcript: ENSGACT00000021511
Sequence length 167
Comment pep:known_by_projection group:BROADS1:groupIV:54018:57292:1 gene:ENSGACG00000016271 transcript:ENSGACT00000021511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIGEGVAALLNPLGIDVDIDVEHEGQRSKVTPPPSANPPTQSGKVEDKVDEARTEGSKV
SRDSDEEWTHLSPKEVDPSTGELQSLQPQDLNQGPPLGQTGLKEAALYPHLPQEADPRLV
ESLSLMLSMGFTDEGGWLTRLLQAKNFDIGAALDAIQYAKPPRSHQP
Download sequence
Identical sequences G3PV33
ENSGACP00000021470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]