SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021498 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021498
Domain Number 1 Region: 565-743
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0013
Further Details:      
 
Domain Number 2 Region: 12-129
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-21
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 722-829
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021498
Domain Number - Region: 346-443
Classification Level Classification E-value
Superfamily Prefoldin 0.0022
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021498   Gene: ENSGACG00000016283   Transcript: ENSGACT00000021539
Sequence length 883
Comment pep:known_by_projection group:BROADS1:groupIV:97772:111852:-1 gene:ENSGACG00000016283 transcript:ENSGACT00000021539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCDQVWTRPLVSSSGDLKLCGFLQKQGGALRSWKQRWFTYEEKKNQLFYYRTPQDVMPL
GQVELCSATFTYTLKAERGTFNIRTPERTFTLKAVSQELMLYWLRQLQVKRWQHIRNSTS
PDPTNHNNNNNTAGEKPVFHNSCIELVRLKIRLNDFLPVLTSPVGLVGEEAANSSSQRTP
LANMSIKHPFIQIQNSVHSLRKLVFPEGSQRTLQRGPPRPPQNRPTTSLQVCTSTTGPTS
AVLTQCKPMCHMSFSAAYKTPAETRPPPLSLESAGRDDLSSDTTSRLQQEKQMLLDDVRA
QKELVWILHKALEASQLEKRTCAEFLAEKSEQERLELLRHREREAADLRGRLEEVKKEAE
SMRRRLNQRDAQLLELQDNIGMLIEKNTAKQEVIIKLSDHVTSCMASDDAFKQLQQDVEN
LKDDIEAYKTQNKFLNSEIHQLTQLWRTSSEQGKSLMVKCSYLEASNCQIESRYLSALRQ
LQEVKSLDQVQRETVQKMIEEALKGEQNCAIKLNVARDHDEYGFKIIPEYEVEDIKLLAK
IQALEIRSHNLLRQEGSERYLSSCWAQYLASRSEELFSSPELKGLLRGGIPQQYRQKVWR
SVVRARTRTLRERHPERYQQLCEKARTCPHPASRQIELDLHRTLTNNQHFSSPSSPALQQ
LRRILLAFSWQNPAIGYCQGLNRLAAIALLVLQSEEDSFWCLVSVVEAIMPPDYYTKDLV
ASQADQRVLKDFLAEKLPRLSAHFEDHNIDVSLITFNWFLVVFVESLPSDILLPLWDAFL
YEGTKKTYKEEDLLKIQDAVEIYQYLRFFTMTISDGRRLATIAFSDMNPFPGRLLRNRRA
FHLSRLEAELRELAEQQREFISESAERRDKVLAVAASEDEEEL
Download sequence
Identical sequences G3PV61
ENSGACP00000021498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]