SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021504 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021504
Domain Number 1 Region: 592-770
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.43e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0013
Further Details:      
 
Domain Number 2 Region: 749-865
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 
Domain Number 3 Region: 21-145
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-21
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021504   Gene: ENSGACG00000016283   Transcript: ENSGACT00000021545
Sequence length 919
Comment pep:known_by_projection group:BROADS1:groupIV:98035:112305:-1 gene:ENSGACG00000016283 transcript:ENSGACT00000021545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLAERKVNHSAKVPKPPDTCRGPPETSREPGDLKLCGFLQKQGGALRSWKQRWFTYEEKK
NQLFYYRTPQDVMPLGQVELCSATFTYTLKAERGTFNIRTPERTFTLKAVSQELMLYWLR
QLQVKRWQHIRNSTSPDPTNHNNNNNTAEPYGYTVNAAAEGIYLQNILRLVKSHDFLPVL
TSPVGLVGEEAANSSSQRTPLANMSIKHPFIQIQCRNSVHSLRKLVFPEGSQSVFYMDAS
TWTPPTSSEPPYNIPTAYKTPAETRPPPLSLESAGQVTPEEGRDHWNRKTKTSPSMVLCR
DDLSSDTTSRLQQEKQMLLDDVRAQKELVWILHKALEASQLEKRTCAEFLAEKSEQERLE
LLRHREREAADLRGRLEEVKKEAESMRRRLNQRDAQLLELQDNIGMLIEKNTAKQEVIIK
LSDHVTSCMASDDAFKQLQQDVENLKILQDDIEAYKTQNKFLNSEIHQLTQLWRTSSEQG
KSLMVKCSYLEASNCQIESRYLSALRQLQEVKSLDQVQRETVQKMIEEALKGEQNCAIKL
NVARDHDEYGFKIIPEYEVEDIKLLAKIQALEIRSHNLLRQEGSERYLSSCWAQYLASRS
EELFSSPELKGLLRGGIPQQYRQKVWRSVVRARTRTLRERHPERYQQLCEKARTCPHPAS
RQIELDLHRTLTNNQHFSSPSSPALQQLRRILLAFSWQNPAIGYCQGLNRLAAIALLVLQ
SEEDSFWCLVSVVEAIMPPDYYTKDLVASQADQRVLKDFLAEKLPRLSAHFEDHNIDVSL
ITFNWFLVVFVESLPSDILLPLWDAFLYEGTKVIFRYALALFKYKEEDLLKIQDAVEIYQ
YLRFFTMTISDGRRLATIAFSDMNPFPGRLLRNRRAFHLSRLEAELRELAEQQREFISES
AERRDKVLAVAASEDEEEL
Download sequence
Identical sequences G3PV67
ENSGACP00000021504 69293.ENSGACP00000021504 ENSGACP00000021504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]