SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021521 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021521
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-88
Family G proteins 0.000000000273
Further Details:      
 
Domain Number 2 Region: 525-631
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-26
Family Pleckstrin-homology domain (PH domain) 0.00000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021521   Gene: ENSGACG00000016290   Transcript: ENSGACT00000021562
Sequence length 844
Comment pep:known_by_projection group:BROADS1:groupIII:9947947:9964037:1 gene:ENSGACG00000016290 transcript:ENSGACT00000021562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLISATAEWAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPVDIEQQIRDMIMQFITRESCLILAVTPANSD
LANSDALKLAKDVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQK
DIDGRKDIKAALEAERKFFLSHSSYRHMAEKMGTPRLQRVLNEQLTNHIRDTLPSFRSKL
QSQLLDLDKEAEEYRGYRPDDPSRKTKQLLQMVQQFSVDFEKRIEGSGDQVDTVELSGGA
KINRIFHERFPFELVKMECDEKEMRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQVIKL
KGPCVKCVDMVIQELINTVRQCSNKLECFPMLREETERIVTSHIRDRESRAKDQVLLLID
IQLSYINTNHEDFIGFANAQQRSSQTNKSQSSAGNQLPSYGCLLVIRKGWLTINNISIMK
GGAKEYWFVLTAESFSWFKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFCIFNTESRN
VYKDNRTLELACDSQEDVESWKSSLLRAGVYPEKVMAVESETTTAADNFSMDPQLERKVE
TIRNLVDSYMAIVNKCIRDLMPKTIMHLMINNVKDFINAELLAQLYSAGDQNALMDESQE
QAQRRDEVLKTHQALKEALAIIGDISTTTITVPVPPPVDSSWVGGPGGARRSPPSSPTAS
RRMSSGQRPSPRGAPPPPNRPGPLGPFNNSADSPQAPSRPNRAPPSIPRNPSRRPPPSPT
RQAP
Download sequence
Identical sequences G3PV84
ENSGACP00000021521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]