SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021541 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021541
Domain Number 1 Region: 35-172
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-37
Family Phosphotyrosine-binding domain (PTB) 0.000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021541   Gene: ENSGACG00000016314   Transcript: ENSGACT00000021582
Sequence length 552
Comment pep:known_by_projection group:BROADS1:groupIII:10029934:10050464:1 gene:ENSGACG00000016314 transcript:ENSGACT00000021582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSAEAELQPGVKTSQRKESRRIKGQDRSEAGLIKRFRGDGVRYKAKLIGIDEVTAARGD
KLCQDSMMKLKGMASSARSKGEHKQRVFLTVSFGGIKIYCERSGVLMHHHSVHEISYIAK
DTRDNRAFGYVCGKEGHHKFVAIKNAQSAEPLIIDLRDLFTLIYDIKQREEMEKKAQKDK
QCEQAVYQTILEDEVDDPVYQYIVFEAGHEPLRGPHSEESVYQVPTSQQKEGIYDVPKRH
FMTNINHFDLFGDMSTPPSMPPSPANTLDPSRSSRQQQHAAELYAPFSPTSMPSGYMTMG
PVQAAQWAQQPFPAQAQTLAFPVQGPLQVAQVLPGGQPVIWSQANIFPATQQQWAAMAAY
MPAQAVGVGGHAIPAAVLQGLVPITTMCPQACDISAPSSAITSPQHAADAALLERQLSLG
GEGLGLDSDAGEGPSTSGAGAAGAGCGVASAGEEEESCSDLDLSRMTLSPGTSTSPSTES
PSTPAPQQSSSSDCPPSQASDAPTDHSPVDPEDNCSNAKEEQSGSGVARSISPAPSGDPE
SSQDQTCPQEDS
Download sequence
Identical sequences G3PVA4
ENSGACP00000021541 ENSGACP00000021541 69293.ENSGACP00000021541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]