SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021580 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021580
Domain Number 1 Region: 924-1101
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00049
Further Details:      
 
Domain Number 2 Region: 506-624
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.32e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00087
Further Details:      
 
Domain Number 3 Region: 300-394
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-21
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 4 Region: 1231-1369
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000493
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 5 Region: 671-802
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000301
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 6 Region: 407-520
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000525
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 7 Region: 8-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000295
Family SAM (sterile alpha motif) domain 0.0057
Further Details:      
 
Domain Number 8 Region: 813-927
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000105
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 9 Region: 1126-1215
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000165
Family Ras-binding domain, RBD 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021580   Gene: ENSGACG00000016344   Transcript: ENSGACT00000021621
Sequence length 1435
Comment pep:known_by_projection group:BROADS1:groupIV:245268:261072:1 gene:ENSGACG00000016344 transcript:ENSGACT00000021621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAADLSVSVLLWLFLFFDSRYLDTFHGAGLLSARDFTHLDNDAFVSLGITATGHRKRILR
LVRHLQRMESQRANQKANPPRDRCQSVSDVSSSQRAHVKPVPKPRTVFNRRRTAPVHFCA
TTDAPPPSTAGSPPPSSRGPHPHPHPPHLHLQLSESPGSPRGGGMEMVSNEIYWGTSPGS
TAPVAGRSYYGQQSAPPTPPRQTPERNRIHQDILRLCRGIPPRGRPLFPMVGEILLKPQK
FSWTKCLSQALHSGDSQGYSTVGEPPHPARYLSLPTHSFSPEADEDLTISPYASYASLTE
RSLPIISSWLDKLSPQGNYVFQKRYVKFDGKNLMYFGSEKDVYAKGVIPLAAIQMARPAK
DNKFEVVTSHRIFVFRTDNEALRRRWVGTLQEHVRDQLVFGQRPFGPGSHCQRHGVLELK
GTKSKVYAAINTEQIWIYKSEQCFRNRIGITVIEARGATIRDGKHKSFDLITPYKKLHFT
AESDREKRDWMEALQEAIAETLSDYEVAEKIWSNRSNRTCADCRAPNPDWASINLCVVIC
KNCAAGQHRGLGTMVSKVQSLKLDTSVWSNEIVQLFIMLGNDRANEFWAARLPATEELDA
DASPDQRRDFISQKYREGRYRLPHPGFNSQEELLKVLCSAVSEQTLLKTVSHIFAEAESV
HFSDASNGCQRHHHQLESDLSVYDEIMQPVLHSGYLYKSSSVHRGTLSRKTREDFQKFWC
TVDRSLVLYESDRSSDPCLQISVKDIVCLGVSRPDSSNNSSGFIDRFRYTFELYLTSEKL
YQFGLETANVLHSWTQSIGKASTPLSCHCLLTREFERVGLLRYRAMLDPQRWKEAFFVLQ
KSNLFICPRTDGAAEDIINLNCLQELSVTFETENHEKKDILVLVEKGRTLHLQGVGRMDF
SLWYSDIQRAAGGKGNALREQQLSRNDIPIIVDSCLAFITQYGLGHEGIYRKNGANSRIK
LLMEEFRKDARNVKLRIGDHFIEDVTDVLKRFFREVEDPVFMADLHSLWQGAAKIPQKGQ
GLDRYKEIIQSFPGVNRPTLAAVFGPLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGKGE
HEVKIIEDLIDNYLYLFDIDEEHQTQIELEISLITTWKDTQLSQAGDLIIEVYLEKKTPD
CCITLKVSPTMSAEELTNQVLFMRNVPAGDKDLWMTFEAMEDGQLERPLHPKERVLEQAL
QWCKMADPSSAYLVVKRVPKGEGITLLTSYKSEIMKIGLLRCREEPPKLLQGNKFQERTF
QIINHKLLLLKDKKSIKPEKEWSLKSMKIYIGIRRKLKAPTRWGFTVMSHKHQLFLCCSC
EDDMWDWITSFLKAQNDDPGPPVLRRHLSSDISKHKFGTMPLVPIRGDESNSSMLSANQT
LRKLHDRRTLSMYFPMKVQKDSFEERSQSPGLPEPLYEEVGDFGLQVLKSLETSF
Download sequence
Identical sequences G3PVE3
ENSGACP00000021580 ENSGACP00000021580 69293.ENSGACP00000021580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]