SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021636 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021636
Domain Number 1 Region: 2233-2504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000644
Further Details:      
 
Domain Number 2 Region: 673-781
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-30
Family Second domain of FERM 0.00033
Further Details:      
 
Domain Number 3 Region: 783-904
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-28
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 4 Region: 1355-1451
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-27
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1991-2086
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-24
Family PDZ domain 0.0098
Further Details:      
 
Domain Number 6 Region: 1094-1196
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family PDZ domain 0.0056
Further Details:      
 
Domain Number 7 Region: 1490-1592
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.025
Further Details:      
 
Domain Number 8 Region: 1768-1854
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-18
Family PDZ domain 0.011
Further Details:      
 
Domain Number 9 Region: 579-672
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-16
Family First domain of FERM 0.0092
Further Details:      
 
Domain Number 10 Region: 1868-1951
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000315
Family PDZ domain 0.032
Further Details:      
 
Domain Number 11 Region: 44-159
Classification Level Classification E-value
Superfamily PAZ domain 0.00000000636
Family PAZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021636   Gene: ENSGACG00000016376   Transcript: ENSGACT00000021677
Sequence length 2512
Comment pep:known_by_projection group:BROADS1:groupXIV:3627318:3656402:-1 gene:ENSGACG00000016376 transcript:ENSGACT00000021677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEVWAVLSQSAESLQELFHKADPAAMGFIISPWSLLLMPSGN
ISFTEEYVTQQDLRAFTAPEVLGGASITSVSDIEKMHMYSLGMTLFWGADYEIPQSQPMR
LGEHLNSLLLNMCDDVTLSRMSLRTVLDICSKHIRNSSGDPPFSYIRKLVRLVLGSLSQV
GKLDGLLTDRESLPERSKEIRERLRGKGLPSGRSAAPRVLERYKARSQEPTALNRGLSRS
MGSLPIQDLLKGDEGAVLQYSQSEHQPHSESPTHPLHPQQKGRPVELDRRSLPFHAVDVG
RSQARKNWASSVDLACIDPDALRFGALEDARRGNSAISTTSIGRRKSPLWASRERDSHFS
EFGGLKSRKPHHHSALSVGSGLSGAYDRIKESQRKLHALRQAVDEENPIHMQQRYHSDYS
SSSESPSVTSSDLDYRQAKKPGEVRRFGSQLALSSEHDGLSLTSHITNRHRLYEGAADEG
LIGAELLLQRQEEEVQRLQAHLAKRLSRANLYPTDDPLAPTRSSMLDLRDPLFTSSIPLR
KPKNFHGPEFVKMAGEPCVSLSVPSSIMKKRGKVEEVQRKVGVVLLNGQKLELSCDIKAV
CKDVLDMVVAHIGLVEHHLFGLAYLRDTDEEFFFVDPEAKLSKVAPEGWKEDPKKKKSDV
PFNVFLRIKFFIDDVNFIQHAMTKHQYYLQLRKDILEERMRCDTENAMLLASLALQAEFS
DYQPELHGKTYFRLEHYVPVSVLDKVDQTTVKEELPKLHSNYFGASDTEAEFEFLKVSQR
LTEYGVHFHRVLPEKRSQTGIMLGVYSKGVHIFEVLNGNRTPVLRFPWRETKKISFIKKK
ICLQNTSDGIKHLFQTDSNKTCQYLLQLCSDQHKFHLQMKARQSNQELQDLENSPLSSFQ
YSLDPRSGDTVGRTVSSGSLAPSLSTRSNPDHLKRISYSEMALHKAPSGPILVQDEVHFP
GFNPVASTALSNPRMMSRSHHNLGQMPESPEPRPAESHRGKSHGRLSQAPPSQVAPHFQQ
HQRASSDTDSILAQQDNTVSHSSPTWSLSKSKEESDSSSTEETGQAYVVGVSMHSPSGPS
TPASVNDSLKKKLTALPSPEREITTVHLKKDVKYGLEGLQVVGGEMSGRADLGTIISSIT
PRGPADVNGCLRPGDRLISVNDVNLEGLSHANATDILQNAPDDVTLVVLQPKESLYKKSS
PSHVQAKSAGKALISSQRRDLDFDTLSEERVGTGSVSTQLSTSSLIHQPPSLGSQDSKPS
SGAKCVERLTGTTTIADRPRPEPNAVLHRAPPALDPAAPALPPKTRKAKVSEAPKVSEHS
DWGDSDMDEETYSSSQEKVKVRKEYNMENVNGNVPEVNSLCPGELFDVELSKKDSSLGIS
VTGGVNTTVRHGGIYIKAILPKGAAELDGRIQKGDRVVAVNGNSLEGATHEQAVEVLRET
GQTVHLLLEKGHLSADRVHVPLTPQCTTASQQDQTRGRERPLQVKDKPEYSFVTRDNVFD
VCLLKNTSGLGFSFSREEHIPDEPPGSSMVRVKKLFPGQPAAESGLIKVGDVIMRVNQTS
LKGLSQHEVISALRGTGQEVNLLLCRPEYQVLPEMDTSAVTPKPSPRKALVTPAQSSLNV
ARDKSPSGTQGRSLVEDVLERLLHKSPGRHNSYSDSTDGDEEVEEAFSTSPVEHRRQTWD
QSVYHTPSSHLGLGRYDSTGQLDDTVTTAFYSPDLSLTRTDLTDVESPPLHVPSSPTAPS
PDPLPPPLPLPLNLTVSGNGQDTEDFVPEVELKVSLVKSEKGSLGFTLTKGNDHGCYIHD
IVQDPAKGDGTLRPGDRMIMVNNTDVSNMGHTEVVNLVRAAPRVVDLVVGRVLEAPKPTL
EAHLLPDISFKGSQDPLGLVLDGGCDSAYDVLFVKDIVPGSVAFEEGSLRPLDLIHYING
APTQDLTLSESTRLMDLSLDDLTLKATRDGKPVSAVQKSVSSFNNNVSSSMNGEDLKDKE
NLVALCPLETSFDMQEELMTLDLEKMPSGGLGFSVIGGERGIFVKSITPGGIAESSGKLQ
VGDRLLKVNEELMTGVSHTKAVTTIRKAQGLVHLIVSRPPDQNPSTYLAYLPINSDRCNG
NTGTSKHRAARPFHYKQDNSTTFSCFTDYEDDPLGHKREAERSAELSEDTDCDGSSLPED
SPETEFPKSGVINSYLQMSAGQPEEDEITWLSNSSAPPPVKDGPIITEDELTSLPLVKVV
PDGQYTGPKLNMVVRMMRGLLEQKVPLQEFDNLQNLQPLDDCLIGQTRENKKKNRYKNIV
PFDTTRVVLGKDGGYINANFINMSVKDENYMYIACQGPLPTTLGDFWQMVWEQKSNVIAM
MTQEVEGGKVKCQRYWPDTPRTAEMVDDRLQITLIKDQYLDNFVIRLIEVKDVQTNEIQR
VTHLNYTGWPDHGTPSQPEQLLTFLSYMRHVHRSGPIVSHCSAGIGRSGTLICIDVVLGL
ISKDADFDLSDVVRNMRLQRQGMIQTEEQYVFCYQVILYVLRCLQAEENISG
Download sequence
Identical sequences G3PVJ7
ENSGACP00000021636 ENSGACP00000021636 69293.ENSGACP00000021636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]