SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021637 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021637
Domain Number 1 Region: 138-418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-72
Family Protein kinases, catalytic subunit 0.00000000257
Further Details:      
 
Domain Number 2 Region: 410-464
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000585
Family SH3-domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021637
Domain Number - Region: 1035-1077
Classification Level Classification E-value
Superfamily UBA-like 0.000542
Family TS-N domain 0.046
Further Details:      
 
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0349
Family SAM (sterile alpha motif) domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021637   Gene: ENSGACG00000016384   Transcript: ENSGACT00000021678
Sequence length 1122
Comment pep:known_by_projection group:BROADS1:groupIII:10189265:10200962:1 gene:ENSGACG00000016384 transcript:ENSGACT00000021678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTEWLLELLMEVQLQQYLLRIRDDLNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPDGGDFPQQGQPASSFRKLSPTPPLGLEEGVLATHP
GGGGGAPLDEQQQALTCLIPEKDLTLFEKLGDGTFGVVKRGEWLTPAGKVLNVAVKCLKT
DVLSQPEALEDFICEVNAMHSLDHQNLIRLYGVVLTHPMKMVTELAPLGSLLERLRCVRP
LGPVLIHTLCQYAVQVACGMAYLEQRRFIHRDLAARNILLASAHRVKIGDFGLMRALPNN
HEHYVMQEHRKVPFAWCAPESLKTRTFSHATDTWMFGVTLWEMFTHGQEPWLGLNGSQIL
HKIDKEGERLPKPEDCPQDVYHVALQCWAQKPDDRPSFVALREFLLETMPTDMCALQDFD
EPDKLHIQINDVITIIEGRAENYWWRGQNKRTLKVGPFPRNVVTSVAGLSAHDISRPLKN
SFIHTGHGDSNPHRCWGFPDRIDDLYLGNPMDPPDVIGVDPGGTRLTQLPGRARKEPPPR
PPQPAVLIKTPCYDAVNDDEDPTSAGLKRLSLWKTASVKGLKLKPSAWVSASKQGSGRIS
GSGHTPGSEVSLIDFGEEFPPPTPSPSPVVEIQIPTLAKLALEAENLLDRTPPQSPRRSL
PRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDMEVRSSNFMETGCLSPVLIPEVEGDAVV
ARGPDRSGLGDNLFLPSKQSQILSTSFSQSAEIFQELQQECMKRLNVPTGSAARSSSPSH
EDKPQIPPRVPIPPRPMKRGDYTSPRWSQDLSLSPTPADVTEDASGQGQPPRIPPRDPLS
QPGSRTPSPMAHHTSCPPAHTYGSYLSSSPGKLMPTTHSFASDPKYAAPKVIQAQGHGRD
SAGKGPCILPIVRDGRKVSSTHYYLLPERPPYLDRYDRFFRETDGQPAGSAEERPLRQAN
TATVRPMVAGGQILQGHAQGQALVQPGELKANFSSNNNSSLGGPRSGMKTSVSLPRVGSD
GPTAAVVAASCGGTEGGGNSADRVKMVQEAVHGVTIEECQGALQNHSWNVQKAVHSLKVE
QLFCLGLRSRAECLKLLEMCDWNLEVASTQMLDNYGSTTRQR
Download sequence
Identical sequences G3PVJ8
ENSGACP00000021637 69293.ENSGACP00000021637 ENSGACP00000021637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]