SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021642 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021642
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.28e-72
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 755-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.44e-52
Family I/LWEQ domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 662-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.29e-50
Family I/LWEQ domain 0.00000464
Further Details:      
 
Domain Number 4 Region: 2297-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.02e-49
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 5 Region: 1841-1975
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.26e-44
Family VBS domain 0.00000966
Further Details:      
 
Domain Number 6 Region: 1227-1362
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.33e-41
Family VBS domain 0.026
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-31
Family Second domain of FERM 0.00000145
Further Details:      
 
Domain Number 8 Region: 1075-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-28
Family VBS domain 0.01
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-23
Family Third domain of FERM 0.0000191
Further Details:      
 
Domain Number 10 Region: 1472-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000104
Family I/LWEQ domain 0.0099
Further Details:      
 
Domain Number 11 Region: 2007-2134
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000022
Family VBS domain 0.026
Further Details:      
 
Domain Number 12 Region: 1696-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000769
Family VBS domain 0.049
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000797
Family Ubiquitin-related 0.066
Further Details:      
 
Domain Number 14 Region: 1584-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000173
Family VBS domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021642
Domain Number - Region: 923-985
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0019
Family I/LWEQ domain 0.0072
Further Details:      
 
Domain Number - Region: 2108-2230
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0209
Family I/LWEQ domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021642   Gene: ENSGACG00000016368   Transcript: ENSGACT00000021683
Sequence length 2543
Comment pep:known_by_projection group:BROADS1:groupII:15069480:15102427:1 gene:ENSGACG00000016368 transcript:ENSGACT00000021683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSLKICIRQCNVVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETVEEKKEDGMGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
GGIQAQIQFGPHIEHKHKQGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVLRVEEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGVIRSGSIGTESLSMGTMPSAQQQITM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MEDDVGGGNDLMRAARTLAGAVSDLLKAVEPASGEPRQTVLTAAGSIGQASGDLLRRIGE
SEADERFQDILMNLAKAVANAAAMLVLKAKNVAQVAEDTGLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCVQACLSATEDGDLLKQVSAAASVVSQA
LGDLLQHVRQYTSRGEPIGRYDQATDTIMTVTESIFTSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKLFNRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKA
VADHIPQLVQGVRGSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAM
QLGQCAKNLATCLAELRTSVQKAHEACGPMEIDSALTAIQTLRSELQDAMLTAMNSKLKP
LPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHYTGIAARETYQALRTLAQAARGV
AASTTDPKAAAAMLDSARDVMEGSALLVHEAKQALVSPGDAESQQRLAQVAKAVSHSLNS
CVNCLPGQKDVDMALKSIGETSKKLLIETIPPASKSFQEAQSELNQTAADLNQSAGEVVH
ASRGSSSQLAVASGKFSEDFDEFLDAGIEMAGHTQKKDDQVQVIGNLKNISMASSKLLLA
AKSLSVDPAAANAKNLLAAAARAVTDSINQLITLCTQQAPGQNECDNALRELEAVRGMLD
NPNEPVSDLSYFECIESVMENSKVLGESLAGISQNCKTGDVPSFGDCVGSASKALCGLTE
AAGQASYLVGVSDPNSQAGHQGLVDPIQFAKANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSDENRKKC
RVATAPLIEAVENLTAFASNPEFASVAAKISNEGFAAQEPILQSARSMLDSSTYLLKTAR
SLVINPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQA
SLAAVSQNLASRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVTQLARYF
EPLIMASVGVTSKLRDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKQASHTHDAIAE
AAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMARLDEGTPPEPEGSFVDYQTSMV
KHSKAIAVSAQEMMTKSVTCPDELGGLASQVTVDYSQLAVQGRLAAHTAEPEEIGFQIKN
RVQELGHGCIFLVQKAGAVQITPSDGFTKRELIECARAVTEKVSLVLSALQTGNKGTQAC
ITAASAVSGIIADLDTTIMFATAGTLNAENDESFADHRENILKTAKALVEDTKMLVSGAA
SGQDRLAQAAQSSAKTITQLTDVVKLGAASIGADDPETQVVLINAIKDVAKALSELISAT
KCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIRQELV
VFQSRDAPNKTTTPEEFIRMTKGITMATAKAVAAGNSARQEDVIHTANLSRKAISDMLTT
CKQASYHPEVSEEVKSRALMFGSECTTGYIDLLEQVLFVLQRPTGDQKQQLAVCSKRVAG
AVTELIQTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADET
LNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGLIPANAVDDGQWSQGLISAAR
MVAAATSNLCEAANASVQGQASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQI
AGNAVKKASDNLVRAAQKAAFDKADEANVVVKTKFVGGIAQIIAAQEEMLRKERELEEAR
KKLAQIRQQQYKFLPSELREDDN
Download sequence
Identical sequences G3PVK3
ENSGACP00000021642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]