SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021644 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021644
Domain Number 1 Region: 2231-2501
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000644
Further Details:      
 
Domain Number 2 Region: 667-775
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-30
Family Second domain of FERM 0.00033
Further Details:      
 
Domain Number 3 Region: 777-898
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-28
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 4 Region: 1370-1469
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-27
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1091-1193
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family PDZ domain 0.0056
Further Details:      
 
Domain Number 6 Region: 1508-1610
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.025
Further Details:      
 
Domain Number 7 Region: 1798-1883
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-18
Family PDZ domain 0.011
Further Details:      
 
Domain Number 8 Region: 573-666
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-16
Family First domain of FERM 0.0092
Further Details:      
 
Domain Number 9 Region: 1897-1980
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000302
Family PDZ domain 0.032
Further Details:      
 
Domain Number 10 Region: 47-162
Classification Level Classification E-value
Superfamily PAZ domain 0.00000000691
Family PAZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021644   Gene: ENSGACG00000016376   Transcript: ENSGACT00000021685
Sequence length 2506
Comment pep:known_by_projection group:BROADS1:groupXIV:3627835:3656402:-1 gene:ENSGACG00000016376 transcript:ENSGACT00000021685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEVWAVLSQSAESLQELFHKVICAYPAAMGFIISPWSLLLMP
SGNISFTEEYVTQQDLRAFTAPEVLGGASITSVSDIEKMHMYSLGMTLFWGADYEIPQSQ
PMRLGEHLNSLLLNMCDDVTLSRMSLRTVLDICSKHIRNSSGDPPFSYIRKLVRLVLGSL
SQLDGLLTDRESLPERSKEIRERLRGKGLPSGRSAAPRVLERYKARSQEPTALNRGLSRS
MGSLPIQDLLKGDEGAVLQYSQSEHQPHSESPTGILPQAPLTPTPTLLSLPAPPSPPARK
NWASSVDLACIDPDALRFGALEDARRGNSAISTTSIGRRKSPLWASRERDSHFSEFGGLK
SRKPHHHSALSVGSGLSGAYDRIKESQRKLHALRQAVDEENPIHMQQRYHSDYSSSSESP
SVTSSDLDYRQAKKPGEVRRFGSQLALSSEHDGLSLTSHITNRHRLYEGAADEGLIGAEL
LLQRQEEEVQRLQAHLAKRLSRANLYPTDDPLAPTRSSMLDLRDPLFTSSIPLRKPKNFH
GPEFVKMAGEPCVSLSVPSSIMKKRGKVEEVQRKVGVVLLNGQKLELSCDIKAVCKDVLD
MVVAHIGLVEHHLFGLAYLRDTDEEFFFVDPEAKLSKVAPEGWKEDPKKKKSDVPFNVFL
RIKFFIDDVNFIQHAMTKHQYYLQLRKDILEERMRCDTENAMLLASLALQAEFSDYQPEL
HGKTYFRLEHYVPVSVLDKVDQTTVKEELPKLHSNYFGASDTEAEFEFLKVSQRLTEYGV
HFHRVLPEKRSQTGIMLGVYSKGVHIFEVLNGNRTPVLRFPWRETKKISFIKKKICLQNT
SDGIKHLFQTDSNKTCQYLLQLCSDQHKFHLQMKARQSNQELQDLENSPLSSFQYSLDPR
SGDTVGRTVSSGSLAPSLSTRSNPDHLKRISYSEMALHKAPSGPILVQDEVHFPGFNPVA
STALSNPRMMSRSHHNLGQMPESPEPRPAESHRGKSHGRLSQAPPSQVAPHFQQHQRASS
DTDSILAQQDKSFGTVSHSSPTWSLSKSKEESDSSSTEETGQAYVVGVSMHSPSGPSTPA
SVNDSLKKKLTALPSPEREITTVHLKKDVKYGLEGLQVVGGEMSGRADLGTIISSITPRG
PADVNGCLRPGDRLISVNDVNLEGLSHANATDILQNAPDDVTLVVLQPKESLYKKSSPSH
VQAKSAGKALISSQRRDLDFDTLSEERVGTGSVSTQLSTSSLIHQPPSLGSQDSKPSSGA
KISPPPANVQQCVERLTGTTTIADRPRPEPNAVLHRAPPALDPAAPALPPKTRKAKVSEA
PKVSEHSDWGDSDMDEETYSSSQEKVKVRKDENSSSSNKHHEYNMENVNGNVPEVNSLCP
GELFDVELSKKDSSLGISVTGGVNTTVRHGGIYIKAILPKGAAELDGRIQKGDRVVAVNG
NSLEGATHEQAVEVLRETGQTVHLLLEKGHLSADRVHVPLTPQCTTASQQDQTRGRERPL
QVKDKPEYSFVTRDNVFDVCLLKNTSGLGFSFSREEHIPDEPPGSSMVRVKKLFPGQPAA
ESGLIKVGDVIMRVNQTSLKGLSQHEVISALRGTGQEVNLLLCRPEYQVLPEMDTSAVTP
KPSPRKALVTPAQSSLNVARDKSPSGTQGRSLVEDVLERLLHKSPGRHNSYSDSTDGDEE
VEEAFSTSPVEHRRQTWDQSVYHTPSSHLGLGRYDSTGQLDDTVTTAFYSPDHVPSSPTA
PSPDPLPPPLPLPLNLTVSGNGQDTEDFVPVRSEERVNVNVSHPRVISLNKIRLCCQEVE
LKVSLVKSEKGSLGFTLTKGNDHGCYIHDIVQDPAKGDGTLRPGDRMIMVNNTDVSNMGH
TEVVNLVRAAPRVVDLVVGRVLEAPKPTLEAHLLPDISFKGSQDPLGLVLDGGCDSAYDV
LFVKDIVPGSVAFEEGSLRPLDLIHYINGAPTQDLTLSESTRLMDLSLDDLTLKATRDGK
PVSAVQKSVSSFNNNVSSSMNGMFLMHKRNNADLHAGGAHDSGSGEDAVRRSGFLCHWRG
KGDLCQVHHTGRNSRVLGQTASRGQAAEMSRPPDQNPSTYLAYLPINSDRCNGNTDKQDN
STTFSCFTDYEDDPLGHKREAERSAELSEDTDCDGSSLPEDSPESSRKVEWQEDHVDDPR
NENNSYLQMSAGQPEEDEITWGSDELPIENINSKSRDVKDGPIITEDELTSLPLVKVVPD
GQYTGPKLNMVVRMMRGLLEQKVPLQEFDNLQNLQPLDDCLIGQTRENKKKNRYKNIVPF
DTTRVVLGKDGGYINANFINMSVKDENYMYIACQGPLPTTLGDFWQMVWEQKSNVIAMMT
QEVEGGKVKCQRYWPDTPRTAEMVDDRLQITLIKDQYLDNFVIRLIEVKDVQTNEIQRVT
HLNYTGWPDHGTPSQPEQLLTFLSYMRHVHRSGPIVSHCSAGIGRSGTLICIDVVLGLIS
KDADFDLSDVVRNMRLQRQGMIQTEEQYVFCYQVILYVLRCLQAEE
Download sequence
Identical sequences G3PVK5
ENSGACP00000021644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]