SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021661 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021661
Domain Number 1 Region: 141-339
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 26-135
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-31
Family Pleckstrin-homology domain (PH domain) 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021661
Domain Number - Region: 671-757
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00303
Family IMD domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021661   Gene: ENSGACG00000016403   Transcript: ENSGACT00000021702
Sequence length 780
Comment pep:known_by_projection group:BROADS1:groupXIV:3690912:3724486:-1 gene:ENSGACG00000016403 transcript:ENSGACT00000021702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQCVSQSGPQRSGGHAGTETQRQGRPCVVRCGWLKKQGGFVKTWHSRWFVLRGDQLHY
YKDEEETKVLGAIFLPGNKVTEHPTSGDEGGKFLFEVIPGGDRERMTANHETYLLMASTQ
NDMEDWVKTIRRVIWAPFGGGIFGQKLEETVRYERRFGSKLAPMLVEQCADFIRQWGLRE
EGLFRLPGQANLVKELQDAFDCGEKPSFDCNTDVHTVASLLKLYLRELPEPVVPFHKFED
FLACTKLLGKDDEMGLKELQQLVNNLPPVNFNLLKYICRFLDEVQSYSGVNKMSVQNLAT
VFGPNILRPKVEDPVAIMEGTVLVQQLMAVLIGRHDVLFPPDEDGPAALELVNNNIELSQ
NAENNNAPVVRQCVWEAPESPSHRQPVDNGGSPRPSSPRNGVAGLFDVARSPPLTIKKNP
AFSKGSGIVTNGSFSSSPSSDPNQEKSPPLTGGRVLPVRRAGTLKGSGTKMGTSGVTSGS
CPAGNGTGGVRMGISSTDGVTGGVSGRNGLWVPNGCVTLRENNRARDSSHGDQTSNQNRL
STYDNVQLNHQNFTITCLNGGHEDKQSVDSATWSTSSCEISLPDNSTSCRSSTTTCPEQD
FYGGHYEDLDGPAQDNERPRSGAGGEAEGRTSNREGSGGGAGRSSQGTSSSNDSDGYSVG
NGAGGHSALHSLVASLKQEMHKQKAEYEARIKSLEQRNLELETEMVVFHEEMDQERKKYT
MAEIKLRNAERAKDDAERRNGMLQKEMEQFFSTFSDLTATGNSTAADPRRPDRNNSIWIQ
Download sequence
Identical sequences G3PVM2
ENSGACP00000021661 69293.ENSGACP00000021661 ENSGACP00000021661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]