SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021670 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021670
Domain Number 1 Region: 136-234
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-28
Family Ras-binding domain, RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 275-380
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000688
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021670   Gene: ENSGACG00000016414   Transcript: ENSGACT00000021711
Sequence length 451
Comment pep:known_by_projection group:BROADS1:groupIII:10346412:10355074:-1 gene:ENSGACG00000016414 transcript:ENSGACT00000021711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHPQMDDIDTMFSHLLGEMDTLSQSLMPAADSPEVDAGSQGNCPISIGFSDLNESLNEME
DQDLDALVADLESTSDGHDPGDQGAGSLAAASATLGPAWEPKAAATLPPPSNSVESSEEM
VEPQTKADRIHLALEKLKEAKVRKLIVKLLMSDGSSKTLMVDERQTVREVLDKLFEKTHC
DCGIDWSLCETNSELQIERGFEDHEHLVELLSAWTRFSENKIYFLSRPQRYLMFTEPQLF
YMWKKKTACLSGIKEEAKQLLIKEHFGGSTVIVPDLEGKLYLKEDGKKLWKPHYFMLRAS
GLYYVPKGKTRAISDLVCFVRFEKVNIYTTKNYKHKYKAPSDFCFVLKHPCIQRESLYVR
FLCCDDKHTLSLWVNSIRIAKYGTVLFENYQTAVKKASGSQPLHFAADKPWGPRGGLRLR
RDRCNEPPRLPLPHSPQVGEEEGESPPQRRP
Download sequence
Identical sequences G3PVN1
69293.ENSGACP00000021670 ENSGACP00000021670 ENSGACP00000021670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]