SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021682 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021682
Domain Number 1 Region: 55-340
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.49e-51
Family TehB-like 0.095
Further Details:      
 
Domain Number 2 Region: 887-1111
Classification Level Classification E-value
Superfamily RNI-like 5.49e-26
Family 28-residue LRR 0.063
Further Details:      
 
Domain Number 3 Region: 595-657
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000222
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021682   Gene: ENSGACG00000016421   Transcript: ENSGACT00000021723
Sequence length 1134
Comment pep:known_by_projection group:BROADS1:groupIX:4055585:4075322:1 gene:ENSGACG00000016421 transcript:ENSGACT00000021723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLMADSKIRQSKRLRAGTRRRYHDDGISDEEIDGRRMFDLEEKVHSERFSSDRILRMEGR
ELTYEFIQRGGLRDPIIFDKPDGLGIKMPDPDFSVNDVKMFVGSRRMIDVMDVSTQKGTE
MSMAQWTRYYETPPTLREKLYNVISLEFSHTKLENLVQRPATVDLIDWVDNMWPRHLKER
QRDSTNSITDMQYPKVQKYCLMSVEGCYTDFHIDFGGTSVWYHILRGGKVFWLIPPTPQN
LELYENWVLSGKQGDIFLGDRASDCQRIELKQGCTFIIPSGWIHAVYTPTDSMVFGGNFL
HSFNIPMQLNICNIEDRTRVPLKFRYPFYYEMCWYVLERYVFSMTKTSYLTPEFQKHTLG
IGMITGKHVGTGDRTCVSLLSPGLKKPCGSDAASEPMMMMEEEEEGEEGCSEEEASEQQS
DKPAVKVLLTALELEGMWNLLGKLEALPSNKKCVPAGIHNAPALITHIKALLKEHANDNQ
KLSYTGIPIVKWPKRQCFEIPLSLKLVSLTSLPLSAPLHQPKWFPSTPIIPRPQKPASSM
SVLRRRRVRCKRCEACMRPECGDCNFCRDMKKFGGPGKLKQTCVLRQCLSPGLPLSAVCE
ICKEPNQEESGDPSLTLMECSNCAQIVHPACLTVQGEGVVNKDLPSCWECPKCVLGITDP
EVNKRQYKGDKSEGVPALCLSCFFLPFPPFVPPLLSPHVQKHVASSPTPHRGKIALHSRG
SHSSRRGFGANRRSLLRGSSAHRGSRGRWDSDPEPPVLLVSDLNDDLLSGSYLTVTLQRP
HKAKRHAGSIVPKLEAAMGLSLNVRHLSRVISQHYGFRRPRLRGNHRGFRDQSSTSSEEE
EATAPPASSALSLLSLPSFKDVGNERGGEKEVWVSVFNYLNRAELLACMTVCKAWYKWTC
DKRLWSHVDVSRCSPLSNPALAGIIKRQPTSLDLSWTPLAKRQLNCLLTRLPGLRELRVA
GLSWSCVSAMVSPTLPYLRLLDLRWCEGIKDSQIKEILIPPGSESSRSRLRNMVTLRLSG
LDISESTLRLLQRHMPQLERLDLAHCKDITDSSIALLAAAGTHTRNSLTELTLAGCSELT
DGCLSYLKRLSSLALLDLRGCKSISRRACDAFISDLSHIALYCMMEEKLIQRLD
Download sequence
Identical sequences G3PVP3
69293.ENSGACP00000021682 ENSGACP00000021682 ENSGACP00000021682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]