SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021711 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021711
Domain Number 1 Region: 205-348
Classification Level Classification E-value
Superfamily PH domain-like 4e-34
Family Third domain of FERM 0.0037
Further Details:      
 
Domain Number 2 Region: 101-207
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-32
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 31-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-23
Family First domain of FERM 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021711   Gene: ENSGACG00000016444   Transcript: ENSGACT00000021752
Sequence length 575
Comment pep:known_by_projection group:BROADS1:groupII:15325635:15337177:1 gene:ENSGACG00000016444 transcript:ENSGACT00000021752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HITELCSADSRDMESHRSVKRRTHGDSHGPHICPLRRDAKGQYLFDLICHHLNLLEKDYF
GIRYVDPDKQRHWLEFTKSIAKQIKSQPPFTMCLRVKFYPPDPAALKEEITRYLVFLQVK
RDLYHGRLLCKTSDAALLAAYVLQAEIGDHDPGKHPQGYSSKFQFFPKHSEKLERRIADI
HKAELIGQSPETSEMNFLQKAQRLETYGVDPHPCKDVSGNPAFLAFTPFGFTVLQGNRRV
HFLKWEEVTKLKFEAKTFHIYANQTEDKKIILTYFAPTPEACKHLWKCGVENQAFFKLEK
SSQVRTVSSSNLFFKGSRFRYSGKVAKEVMEQSAKIKRDPPEIHRHGMVPSRSCPSITHG
PRLTSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGDSFMSSRGHLEDGSEASTSA
VISDEAYSPSDSMLSTPVAEHGAEVPPARHLNGAPRSVDEQGSQAGASREGHAAEFPADR
RAPRRKAASSSPPSDVEELNKFILSVLRLFLVTIGLLFALLLLLIMLTESDLDIAFLRDI
RKTPEFQQFHFEYFCPLRRWFACKLRWVGGLLVSK
Download sequence
Identical sequences G3PVS2
ENSGACP00000021711 ENSGACP00000021711 69293.ENSGACP00000021711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]